Inicio

10% de descuento en tu primera compra

con el código:



BIENVE10



10% de Descuento para compras superiores a 250 €

Descuento no aplicable a productos en promoción

No combinable con otros códigos descuento.

Producto añadido a la lista de deseos
Load Time 1685 ms
Querying Time 341 ms
Queries 1056
Memory Peak Usage 32.1 Mb
Included Files 1384 files - 15.75 Mb
PrestaShop Cache - Mb
Global vars 0.23 Mb
PrestaShop Version 8.2.3
PHP Version 8.1.33
MySQL Version 10.11.13-MariaDB-0ubuntu0.24.04.1
Memory Limit 512M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 146.682 ms 146.682 ms 2.92 Mb 2.9 Mb
__construct 4.024 ms 150.706 ms 0.01 Mb 3.7 Mb
init 27.893 ms 178.599 ms 0.74 Mb 3.9 Mb
checkAccess 0.002 ms 178.601 ms - Mb 3.9 Mb
setMedia 3.782 ms 182.383 ms 0.03 Mb 3.9 Mb
postProcess 0.001 ms 182.384 ms - Mb 3.9 Mb
initHeader 0.001 ms 182.385 ms - Mb 3.9 Mb
initContent 941 ms 1123 ms 7.95 Mb 11.7 Mb
initFooter 0.003 ms 1123 ms - Mb 11.7 Mb
display 562.170 ms 1685 ms 19.75 Mb 32.1 Mb
Hook Time Memory Usage
displayLeftColumn 126.917 ms 9.38 Mb
DisplayProductCampagains 92.438 ms 1.11 Mb
DisplayHeader 50.253 ms 1.44 Mb
ProductSearchProvider 13.211 ms - Mb
displayProductListFunctionalButtons 10.193 ms 0.02 Mb
displayBeforeBodyClosingTag 9.291 ms 0.18 Mb
DisplayTop 6.859 ms 0.89 Mb
Header 6.192 ms 0.02 Mb
DisplayBanner 5.155 ms 0.63 Mb
DisplayBeforeBodyClosingTag 4.206 ms 0.16 Mb
displayFooter 2.893 ms 0.13 Mb
displayNav1 2.580 ms 0.08 Mb
displayCountDown 2.535 ms 0.08 Mb
DisplayLeftColumn 1.933 ms 0.07 Mb
displayNav2 1.673 ms 0.13 Mb
DisplayNavFullWidth 1.360 ms 0.03 Mb
displayMainMenu 1.191 ms 0.14 Mb
displayCustomerLoginFormAfter 1.146 ms 0.06 Mb
ActionFrontControllerSetMedia 0.974 ms 0.01 Mb
DisplayPaCaptcha 0.907 ms 0.01 Mb
IsJustElementor 0.449 ms 0.02 Mb
DisplayFooter 0.044 ms - Mb
ActionModuleRegisterHookAfter 0.018 ms - Mb
ModuleRoutes 0.010 ms - Mb
displayVerticalMenu 0.010 ms - Mb
ActionDispatcher 0.008 ms - Mb
DisplayOverrideTemplate 0.008 ms - Mb
ActionProductSearchAfter 0.006 ms - Mb
DisplayContentWrapperTop 0.003 ms - Mb
29 hook(s) 342.463 ms 14.57 Mb
Module Time Memory Usage
ph_simpleblog 6.561 ms 0.12 Mb
iqitthemeeditor 1.408 ms 0.16 Mb
ps_emailsubscription 2.045 ms 0.06 Mb
iqitproductvariants 0.929 ms 0.01 Mb
ps_emailalerts 0.345 ms 0.01 Mb
ets_payment_with_fee 1.098 ms 0.09 Mb
revsliderprestashop 26.455 ms 1.62 Mb
ps_shoppingcart 0.274 ms 0.01 Mb
acactiv 0.582 ms - Mb
paypal 12.711 ms 0.15 Mb
iqitpopup 2.206 ms 0.02 Mb
iqitsizecharts 0.672 ms 0.05 Mb
iqitreviews 0.603 ms 0.01 Mb
iqitextendedproduct 0.931 ms 0.01 Mb
iqitelementor 3.018 ms 0.04 Mb
iqitmegamenu 2.527 ms 0.17 Mb
ets_recaptcha_free 1.596 ms 0.02 Mb
feedelmercaderio 0.887 ms - Mb
seigicookie 47.616 ms 1.97 Mb
ps_customeraccountlinks 0.250 ms 0.01 Mb
cronjobs 0.559 ms - Mb
ps_mbo 14.247 ms 0.12 Mb
mycustomscripts 2.372 ms 0.01 Mb
sendinblue 2.439 ms 0.03 Mb
iqitcountdown 3.400 ms 0.09 Mb
iqitsociallogin 1.774 ms 0.07 Mb
iqitfreedeliverycount 0.488 ms 0.01 Mb
ps_googleanalytics 5.651 ms 0.16 Mb
iqitcontactpage 1.585 ms 0.06 Mb
iqitwishlist 20.379 ms 0.20 Mb
ps_facetedsearch 17.389 ms 0.09 Mb
iqitlinksmanager 4.077 ms 0.11 Mb
ps_languageselector 0.547 ms 0.05 Mb
ps_currencyselector 0.474 ms 0.05 Mb
iqitsearch 0.452 ms 0.01 Mb
ps_customersignin 0.160 ms 0.01 Mb
pscartbanner 0.416 ms 0.01 Mb
iqitproductflags 93.174 ms 1.20 Mb
ps_categorytree 127.109 ms 9.39 Mb
39 module(s) 409.407 ms 16.13 Mb

Stopwatch SQL - 1056 queries

# Query Time (ms) Rows Filesort Group By Location
97
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM ps_product p LEFT JOIN ps_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN ps_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN ps_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN ps_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN ps_category_product cp ON (p.id_product = cp.id_product) INNER JOIN ps_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN ps_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN ps_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND p.id_manufacturer IN (4, 10, 25, 22) AND c.nleft>=2 AND c.nright<=321 GROUP BY p.id_product) p INNER JOIN ps_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
13.625 ms 230464 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
384
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 332
11.127 ms 1 /classes/Product.php:2902
200
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 281 LIMIT 1
11.072 ms 1 /classes/Category.php:1378
392
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 336
4.684 ms 1 /classes/Product.php:2902
248
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1202
ORDER BY f.position ASC
2.891 ms 1 Yes /classes/Product.php:6032
629
SELECT SQL_NO_CACHE c.*, cl.*
FROM `ps_category` c
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `ps_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
LEFT JOIN `ps_category_group` cg ON c.`id_category` = cg.`id_category`
RIGHT JOIN `ps_category` c2 ON c2.`id_category` = 2 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright`
WHERE 1 AND c.`level_depth` <= 5 AND `id_lang` = 1
AND c.`active` = 1
AND cg.`id_group` IN (1)
GROUP BY c.`id_category`
ORDER BY c.`level_depth` ASC, category_shop.`position` ASC
2.862 ms 116 Yes Yes /classes/Category.php:799
115
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `ps_hook_module` hm
STRAIGHT_JOIN `ps_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `ps_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.837 ms 630 /classes/Hook.php:459
228
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 1201 LIMIT 1
2.818 ms 1 /classes/Pack.php:89
382
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1677, 1678, 1679, 1680, 1681, 1682, 1683, 1684, 1685, 1686, 1687, 1688, 1689, 1690, 1691, 1692, 1693, 1694, 1695, 1696, 1697, 1698, 1699, 1700, 1701, 1702, 1703, 1704, 1705, 1706, 1707, 1708, 1709, 1710, 1711, 1712, 1713, 1714, 1715, 1716, 1717, 1718, 1719, 1720, 1721, 1722, 1723, 1724, 1725, 1726, 1727, 1728, 1729, 1730, 1731, 1732, 1733, 1734, 1735, 1736, 1737, 1738, 1739, 1740, 1741, 1742, 1743, 1744, 1745, 1746, 1747, 1748, 1749, 1750, 1751, 1752, 1753, 1754, 1755, 1756, 1757, 1758, 1759, 1760, 1761, 1762, 1763, 1764, 1765, 1766, 1767, 1768, 1769, 1770, 1771, 1772, 1773, 1774, 1775, 1776) AND il.`id_lang` = 1 ORDER by i.`position`
2.726 ms 500 Yes /classes/Product.php:2921
375
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1202
ORDER BY `position`
2.613 ms 29 Yes /classes/Product.php:3545
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `ps_configuration` c
LEFT JOIN `ps_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
2.446 ms 1762 /classes/Configuration.php:180
88
SELECT SQL_NO_CACHE * FROM ps_hook_module
WHERE `id_hook` = 0
AND `id_module` = 196
AND `id_shop` = 1
2.283 ms 0 /classes/Hook.php:518
364
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 357
ORDER BY `position`
2.217 ms 1 Yes /classes/Product.php:3545
390
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 335
2.166 ms 1 /classes/Product.php:2902
295
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 332 LIMIT 1
1.970 ms 1 /classes/Pack.php:90
218
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1378) LIMIT 1
1.892 ms 1 /src/Adapter/EntityMapper.php:71
277
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1205) AND (id_product_attribute = 1737) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.852 ms 1 /classes/stock/StockAvailable.php:453
209
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 1200 LIMIT 1
1.795 ms 1 /classes/Pack.php:89
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `ps_module` m
INNER JOIN ps_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `ps_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `ps_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `ps_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.719 ms 186 Yes Yes /classes/Hook.php:1289
114
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 351 AND id_shop=1 LIMIT 1
1.650 ms 1 /classes/Product.php:6887
201
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 281 LIMIT 1
1.522 ms 1 /classes/Product.php:5670
333
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 335 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.504 ms 10 Yes /classes/SpecificPrice.php:576
565
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1205) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.474 ms 100 Yes Yes /classes/Product.php:4524
134
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 353 AND id_shop=1 LIMIT 1
1.458 ms 1 /classes/Product.php:6887
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 360 AND id_shop=1 LIMIT 1
1.416 ms 1 /classes/Product.php:6887
140
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 353
ORDER BY f.position ASC
1.398 ms 1 Yes /classes/Product.php:6032
259
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1203 AND `id_group` = 1 LIMIT 1
1.397 ms 0 /classes/GroupReduction.php:156
178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 358 AND id_shop=1 LIMIT 1
1.395 ms 1 /classes/Product.php:6887
153
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 354 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 354 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.352 ms 0 /classes/Cart.php:1430
285
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 204 LIMIT 1
1.326 ms 1 /classes/Category.php:1378
84
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `ps_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `ps_hook_alias` ha
INNER JOIN `ps_hook` h ON ha.name = h.name
1.310 ms 0 /classes/Hook.php:1348
220
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1201
AND image_shop.`cover` = 1 LIMIT 1
1.266 ms 22 /classes/Product.php:3570
377
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1627, 1628, 1630, 1632, 1633, 1634, 1635, 1636, 1637, 1638, 1640, 1641, 1642, 1645, 1646, 1647, 1648, 2172, 2173, 2174, 2175, 2176, 2177, 2178, 2179, 2180, 2181, 2182) AND il.`id_lang` = 1 ORDER by i.`position`
1.250 ms 56 Yes /classes/Product.php:2921
177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 358)
1.245 ms 1 /classes/Product.php:3860
163
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 357 AND id_shop=1 LIMIT 1
1.236 ms 1 /classes/Product.php:6887
330
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 335) AND (b.`id_shop` = 1) LIMIT 1
1.233 ms 1 /src/Adapter/EntityMapper.php:71
380
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1205
ORDER BY `position`
1.211 ms 54 Yes /classes/Product.php:3545
126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 351
ORDER BY f.position ASC
1.166 ms 1 Yes /classes/Product.php:6032
256
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 1203 LIMIT 1
1.092 ms 1 /classes/SpecificPrice.php:435
109
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE `from` BETWEEN '2025-12-23 00:00:00' AND '2025-12-23 23:59:59' LIMIT 1
1.083 ms 1 /classes/SpecificPrice.php:377
185
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 360
AND image_shop.`cover` = 1 LIMIT 1
1.077 ms 1 /classes/Product.php:3570
351
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 336 LIMIT 1
1.073 ms 1 /classes/Pack.php:89
217
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1378
AND agl.`id_lang` = 1
1.056 ms 2 /classes/Product.php:7546
146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 354 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.028 ms 10 Yes /classes/SpecificPrice.php:576
127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 353
AND image_shop.`cover` = 1 LIMIT 1
1.023 ms 1 /classes/Product.php:3570
155
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 357
AND image_shop.`cover` = 1 LIMIT 1
1.022 ms 1 /classes/Product.php:3570
183
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 358 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 358 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.012 ms 0 /classes/Cart.php:1430
119
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 351 AND `id_group` = 1 LIMIT 1
1.012 ms 0 /classes/GroupReduction.php:156
170
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 358
AND image_shop.`cover` = 1 LIMIT 1
1.008 ms 1 /classes/Product.php:3570
130
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 353 LIMIT 1
0.997 ms 10 /classes/SpecificPrice.php:435
145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 354
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.994 ms 1 /classes/SpecificPrice.php:259
251
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1635
0.972 ms 1 /src/Adapter/EntityMapper.php:79
182
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.951 ms 1 /classes/stock/StockAvailable.php:453
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `ps_hook` h
WHERE (h.active = 1)
0.909 ms 1014 /classes/Hook.php:1388
99
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2025-12-23 00:00:00',
INTERVAL 365 DAY
)
) > 0) as new
FROM ps_product p
LEFT JOIN ps_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN ps_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN ps_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (351,353,354,357,358,360,1200,1201,1202,1203,1205,332,333,334,335,336)
0.890 ms 16 /classes/ProductAssembler.php:95
93
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM ps_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.889 ms 3 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
263
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1203 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1203 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.878 ms 0 /classes/Cart.php:1430
108
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `ps_specific_price` WHERE `id_product` != 0
0.867 ms 458 /classes/SpecificPrice.php:310
327
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 334
ORDER BY f.position ASC
0.860 ms 2 Yes /classes/Product.php:6032
122
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 351 LIMIT 1
0.855 ms 1 /classes/Pack.php:89
356
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 351
ORDER BY `position`
0.852 ms 1 Yes /classes/Product.php:3545
94
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `ps_manufacturer` m INNER JOIN ps_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `ps_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.828 ms 35 Yes /classes/Manufacturer.php:211
116
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.822 ms 1 /classes/tax/TaxRulesTaxManager.php:109
388
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 334
0.821 ms 1 /classes/Product.php:2902
128
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 241 LIMIT 1
0.810 ms 1 /classes/Product.php:5670
313
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 333
ORDER BY f.position ASC
0.809 ms 2 Yes /classes/Product.php:6032
118
SELECT SQL_NO_CACHE *
FROM `ps_tax_lang`
WHERE `id_tax` = 1
0.808 ms 3 /src/Adapter/EntityMapper.php:79
486
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1200) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.803 ms 26 Yes Yes /classes/Product.php:4524
20
SELECT SQL_NO_CACHE `id_product`
FROM `ps_product_lang`
WHERE `link_rewrite` = 'inicio' AND `id_lang` = 1 LIMIT 1
0.802 ms 554 /override/classes/Dispatcher.php:346
181
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 358 LIMIT 1
0.797 ms 1 /classes/Pack.php:90
157
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 243 LIMIT 1
0.781 ms 1 /classes/Product.php:5670
309
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 333 LIMIT 1
0.765 ms 1 /classes/Pack.php:89
292
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 332 AND id_shop=1 LIMIT 1
0.759 ms 1 /classes/Product.php:6887
355
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 336
ORDER BY f.position ASC
0.754 ms 2 Yes /classes/Product.php:6032
266
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 282 LIMIT 1
0.751 ms 1 /classes/Product.php:5670
171
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 240 LIMIT 1
0.746 ms 1 /classes/Category.php:1378
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `ps_hook`
0.729 ms 1014 /classes/Hook.php:1348
275
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.713 ms 1 /classes/stock/StockAvailable.php:453
107
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE `id_product` != 0 LIMIT 1
0.707 ms 1373 /classes/SpecificPrice.php:297
50
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `ps_category` c
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `ps_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.680 ms 14 Yes Yes /classes/Category.php:924
305
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 333 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.670 ms 10 Yes /classes/SpecificPrice.php:576
1050
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `ps_category_product` cp
LEFT JOIN `ps_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `ps_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (351,353,354,357,358,360,1200,1201,1202,1203,1205,332,333,334,335,336) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
0.656 ms 50 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
346
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 336
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.655 ms 1 /classes/SpecificPrice.php:259
317
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 334 LIMIT 1
0.652 ms 10 /classes/SpecificPrice.php:435
213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1200) AND (id_product_attribute = 1378) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.647 ms 1 /classes/stock/StockAvailable.php:453
373
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1201
ORDER BY `position`
0.639 ms 22 Yes /classes/Product.php:3545
21
SELECT SQL_NO_CACHE c.`id_category`, c.`id_parent`, c.`is_root_category`, cl.`name`, cl.`link_rewrite`
FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN ps_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cl.`id_lang` = 1
AND c.`id_category` != 1
GROUP BY c.id_category
0.636 ms 83 Yes /override/classes/Dispatcher.php:414
347
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 336 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.633 ms 10 Yes /classes/SpecificPrice.php:576
372
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `ps_product_attribute_image` pai
LEFT JOIN `ps_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `ps_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1378, 1379, 1380, 1381, 1382, 1383, 1384, 1385, 1386, 1387, 1388, 1389, 1390, 1391, 1392, 1393, 1394, 1395, 1396, 1397, 1398, 1399, 1400, 1401, 1402, 1403) AND il.`id_lang` = 1 ORDER by i.`position`
0.631 ms 101 Yes /classes/Product.php:2921
136
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 353 LIMIT 1
0.623 ms 1 /classes/Pack.php:89
323
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 334 LIMIT 1
0.621 ms 1 /classes/Pack.php:89
505
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `ps_product_attribute_combination` pac
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pac.id_product_attribute IN (1627,1628,1630,1632,1633,1634,1635,1636,1637,1638,1640,1641,1642,1645,1646,1647,1648,2172,2173,2174,2175,2176,2177,2178,2179,2180,2181,2182)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
0.621 ms 28 /classes/Product.php:2752
344
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 336) AND (b.`id_shop` = 1) LIMIT 1
0.620 ms 1 /src/Adapter/EntityMapper.php:71
348
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 336)
0.619 ms 1 /classes/Product.php:3860
385
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 333
ORDER BY `position`
0.611 ms 4 Yes /classes/Product.php:3545
211
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.602 ms 1 /classes/stock/StockAvailable.php:453
203
SELECT SQL_NO_CACHE `name`
FROM `ps_manufacturer`
WHERE `id_manufacturer` = 25
AND `active` = 1 LIMIT 1
0.591 ms 1 /classes/Manufacturer.php:316
324
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 334 LIMIT 1
0.589 ms 1 /classes/Pack.php:90
287
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 332) AND (b.`id_shop` = 1) LIMIT 1
0.588 ms 1 /src/Adapter/EntityMapper.php:71
892
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 139 AND c.`nright` >= 140 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.581 ms 161 Yes /classes/Category.php:1600
534
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1202) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.580 ms 28 Yes Yes /classes/Product.php:4524
318
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 334
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.579 ms 1 /classes/SpecificPrice.php:259
341
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 335
ORDER BY f.position ASC
0.572 ms 2 Yes /classes/Product.php:6032
104
SELECT SQL_NO_CACHE `name`
FROM `ps_manufacturer`
WHERE `id_manufacturer` = 10
AND `active` = 1 LIMIT 1
0.571 ms 1 /classes/Manufacturer.php:316
343
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 201 LIMIT 1
0.570 ms 1 /classes/Product.php:5670
381
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1205
0.570 ms 100 /classes/Product.php:2902
194
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 360 LIMIT 1
0.559 ms 1 /classes/Pack.php:89
340
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 335 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 335 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.559 ms 0 /classes/Cart.php:1430
260
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 1203 LIMIT 1
0.557 ms 1 /classes/Pack.php:89
148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 354 AND id_shop=1 LIMIT 1
0.556 ms 1 /classes/Product.php:6887
349
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 336 AND id_shop=1 LIMIT 1
0.553 ms 1 /classes/Product.php:6887
284
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 332
AND image_shop.`cover` = 1 LIMIT 1
0.538 ms 4 /classes/Product.php:3570
175
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 358
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.527 ms 1 /classes/SpecificPrice.php:259
488
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1382
AND agl.`id_lang` = 1
0.520 ms 2 /classes/Product.php:7546
308
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 333 AND `id_group` = 1 LIMIT 1
0.502 ms 0 /classes/GroupReduction.php:156
474
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (351) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.497 ms 1 Yes Yes /classes/Product.php:4524
489
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1384
AND agl.`id_lang` = 1
0.489 ms 2 /classes/Product.php:7546
298
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 332
ORDER BY f.position ASC
0.487 ms 1 Yes /classes/Product.php:6032
290
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 332 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.479 ms 9 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1205) AND (b.`id_shop` = 1) LIMIT 1
0.474 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 360
ORDER BY `position`
0.472 ms 1 Yes /classes/Product.php:3545
279
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1205 AND pa.`id_product` = 1205 AND pa.`id_product_attribute` = 1737 LIMIT 1
0.461 ms 1 /classes/Product.php:1209
504
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1202
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
0.456 ms 28 Yes /classes/Product.php:2734
320
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 334)
0.453 ms 1 /classes/Product.php:3860
283
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1737
0.444 ms 1 /src/Adapter/EntityMapper.php:79
133
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 353)
0.439 ms 1 /classes/Product.php:3860
311
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 333) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.432 ms 1 /classes/stock/StockAvailable.php:453
314
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 334
AND image_shop.`cover` = 1 LIMIT 1
0.431 ms 4 /classes/Product.php:3570
484
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (360) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.424 ms 1 Yes Yes /classes/Product.php:4524
394
SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-12-23 00:00:00" AND date_to <= "2025-12-23 23:59:59") OR (date_from >= "2025-12-23 00:00:00" AND date_from <= "2025-12-23 23:59:59") OR (date_from < "2025-12-23 00:00:00" AND date_to > "2025-12-23 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.422 ms 1 /classes/CartRule.php:357
19
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `ps_meta` m
LEFT JOIN `ps_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.421 ms 65 Yes /classes/Dispatcher.php:654
179
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 358 AND `id_group` = 1 LIMIT 1
0.417 ms 0 /classes/GroupReduction.php:156
487
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1380
AND agl.`id_lang` = 1
0.414 ms 2 /classes/Product.php:7546
354
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 336 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 336 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.412 ms 0 /classes/Cart.php:1430
383
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 332
ORDER BY `position`
0.412 ms 4 Yes /classes/Product.php:3545
106
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 351 LIMIT 1
0.410 ms 10 /classes/SpecificPrice.php:435
159
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 357 LIMIT 1
0.407 ms 10 /classes/SpecificPrice.php:435
490
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1386
AND agl.`id_lang` = 1
0.405 ms 2 /classes/Product.php:7546
334
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 335)
0.402 ms 1 /classes/Product.php:3860
105
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 0 LIMIT 1
0.401 ms 1 /classes/SpecificPrice.php:426
772
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 79 AND c.`nright` >= 80 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.401 ms 161 Yes /classes/Category.php:1600
326
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 334 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 334 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.399 ms 0 /classes/Cart.php:1430
319
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 334 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.399 ms 10 Yes /classes/SpecificPrice.php:576
300
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 201 LIMIT 1
0.392 ms 1 /classes/Category.php:1378
180
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 358 LIMIT 1
0.389 ms 1 /classes/Pack.php:89
257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1203)
0.388 ms 1 /classes/Product.php:3860
391
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 336
ORDER BY `position`
0.387 ms 4 Yes /classes/Product.php:3545
255
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1203) AND (b.`id_shop` = 1) LIMIT 1
0.382 ms 1 /src/Adapter/EntityMapper.php:71
112
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 351 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.381 ms 10 Yes /classes/SpecificPrice.php:576
144
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 354 LIMIT 1
0.376 ms 10 /classes/SpecificPrice.php:435
476
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (353) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.373 ms 1 Yes Yes /classes/Product.php:4524
335
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 335 AND id_shop=1 LIMIT 1
0.371 ms 1 /classes/Product.php:6887
613
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1773
AND agl.`id_lang` = 1
0.371 ms 2 /classes/Product.php:7546
245
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1635) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.368 ms 1 /classes/stock/StockAvailable.php:453
480
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (357) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.366 ms 1 Yes Yes /classes/Product.php:4524
387
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 334
ORDER BY `position`
0.365 ms 4 Yes /classes/Product.php:3545
322
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 334 AND `id_group` = 1 LIMIT 1
0.364 ms 0 /classes/GroupReduction.php:156
768
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 77 AND c.`nright` >= 78 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.364 ms 161 Yes /classes/Category.php:1600
132
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 353 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.362 ms 10 Yes /classes/SpecificPrice.php:576
270
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1205)
0.362 ms 100 /classes/Product.php:3860
636
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 5 AND c.`nright` >= 6 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.358 ms 4 /classes/Category.php:1600
328
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 335
AND image_shop.`cover` = 1 LIMIT 1
0.357 ms 4 /classes/Product.php:3570
852
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 119 AND c.`nright` >= 120 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.357 ms 161 Yes /classes/Category.php:1600
103
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 351) AND (b.`id_shop` = 1) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
244
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1202 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1202 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.354 ms 0 /classes/Cart.php:1430
278
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1737
AND cp.`id_cart` = 0 AND cp.`id_product` = 1205 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1737
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1205 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.354 ms 0 /classes/Cart.php:1430
294
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 332 LIMIT 1
0.354 ms 1 /classes/Pack.php:89
500
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1201) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.354 ms 1 Yes Yes /classes/Product.php:4524
17
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.353 ms 118 /classes/module/Module.php:346
231
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1201 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1201 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.352 ms 0 /classes/Cart.php:1430
482
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (358) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.352 ms 1 Yes Yes /classes/Product.php:4524
212
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1200 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1200 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.351 ms 0 /classes/Cart.php:1430
389
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 335
ORDER BY `position`
0.349 ms 4 Yes /classes/Product.php:3545
543
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1628
AND agl.`id_lang` = 1
0.349 ms 1 /classes/Product.php:7546
190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 360 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.348 ms 10 Yes /classes/SpecificPrice.php:576
616
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (332) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.347 ms 1 Yes Yes /classes/Product.php:4524
622
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (334) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.347 ms 1 Yes Yes /classes/Product.php:4524
161
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 357 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.347 ms 10 Yes /classes/SpecificPrice.php:576
478
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (354) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.346 ms 1 Yes Yes /classes/Product.php:4524
312
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 333 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 333 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.341 ms 0 /classes/Cart.php:1430
535
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1648
AND agl.`id_lang` = 1
0.341 ms 1 /classes/Product.php:7546
100
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 351
AND image_shop.`cover` = 1 LIMIT 1
0.340 ms 1 /classes/Product.php:3570
940
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 165 AND c.`nright` >= 166 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.340 ms 161 Yes /classes/Category.php:1600
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM ps_shop_url su
LEFT JOIN ps_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'sonelpro.com' OR su.domain_ssl = 'sonelpro.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.339 ms 1 Yes /classes/shop/Shop.php:1364
321
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 334 AND id_shop=1 LIMIT 1
0.339 ms 1 /classes/Product.php:6887
249
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1635
AND agl.`id_lang` = 1
0.338 ms 1 /classes/Product.php:7546
378
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1203
ORDER BY `position`
0.335 ms 3 Yes /classes/Product.php:3545
395
SELECT SQL_NO_CACHE * FROM `ps_cart_rule` cr
LEFT JOIN `ps_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.334 ms 1 /classes/CartRule.php:423
872
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 129 AND c.`nright` >= 130 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.331 ms 161 Yes /classes/Category.php:1600
281
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1737
AND agl.`id_lang` = 1
0.331 ms 2 /classes/Product.php:7546
276
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1205 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1205 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.329 ms 0 /classes/Cart.php:1430
173
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 358) AND (b.`id_shop` = 1) LIMIT 1
0.327 ms 1 /src/Adapter/EntityMapper.php:71
563
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1203) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.326 ms 1 Yes Yes /classes/Product.php:4524
176
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `ps_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 358 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2025-12-23 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.325 ms 10 Yes /classes/SpecificPrice.php:576
125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 351 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 351 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.325 ms 0 /classes/Cart.php:1430
297
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 332 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 332 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.323 ms 0 /classes/Cart.php:1430
202
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1200) AND (b.`id_shop` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
540
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2172
AND agl.`id_lang` = 1
0.320 ms 1 /classes/Product.php:7546
776
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 81 AND c.`nright` >= 82 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.319 ms 161 Yes /classes/Category.php:1600
342
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 336
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 4 /classes/Product.php:3570
393
SELECT SQL_NO_CACHE c.id_elementor FROM ps_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.317 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
537
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2173
AND agl.`id_lang` = 1
0.317 ms 1 /classes/Product.php:7546
544
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2175
AND agl.`id_lang` = 1
0.316 ms 1 /classes/Product.php:7546
626
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (336) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.316 ms 1 Yes Yes /classes/Product.php:4524
219
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute_lang`
WHERE `id_product_attribute` = 1378
0.315 ms 1 /src/Adapter/EntityMapper.php:79
473
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 351
0.314 ms 3 /classes/Product.php:3423
729
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 140) AND (b.`id_shop` = 1) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
288
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 332 LIMIT 1
0.313 ms 9 /classes/SpecificPrice.php:435
868
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 127 AND c.`nright` >= 128 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.313 ms 161 Yes /classes/Category.php:1600
1003
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 202 AND c.`nright` >= 203 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.312 ms 161 Yes /classes/Category.php:1600
570
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1685
AND agl.`id_lang` = 1
0.311 ms 2 /classes/Product.php:7546
574
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1693
AND agl.`id_lang` = 1
0.311 ms 2 /classes/Product.php:7546
620
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (333) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.311 ms 1 Yes Yes /classes/Product.php:4524
551
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2177
AND agl.`id_lang` = 1
0.310 ms 1 /classes/Product.php:7546
567
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1679
AND agl.`id_lang` = 1
0.310 ms 2 /classes/Product.php:7546
602
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1751
AND agl.`id_lang` = 1
0.310 ms 2 /classes/Product.php:7546
614
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1775
AND agl.`id_lang` = 1
0.310 ms 2 /classes/Product.php:7546
168
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 357 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 357 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.310 ms 0 /classes/Cart.php:1430
539
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1646
AND agl.`id_lang` = 1
0.310 ms 1 /classes/Product.php:7546
624
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (335) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.310 ms 1 Yes Yes /classes/Product.php:4524
547
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1633
AND agl.`id_lang` = 1
0.309 ms 1 /classes/Product.php:7546
864
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 125 AND c.`nright` >= 126 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.308 ms 161 Yes /classes/Category.php:1600
566
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1677
AND agl.`id_lang` = 1
0.308 ms 2 /classes/Product.php:7546
23
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.305 ms 118 /classes/module/Module.php:346
139
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 353 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 353 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.304 ms 0 /classes/Cart.php:1430
536
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1641
AND agl.`id_lang` = 1
0.304 ms 1 /classes/Product.php:7546
816
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 101 AND c.`nright` >= 102 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.302 ms 161 Yes /classes/Category.php:1600
876
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 131 AND c.`nright` >= 132 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.302 ms 161 Yes /classes/Category.php:1600
370
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1200
ORDER BY `position`
0.302 ms 16 Yes /classes/Product.php:3545
538
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1632
AND agl.`id_lang` = 1
0.302 ms 1 /classes/Product.php:7546
541
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1645
AND agl.`id_lang` = 1
0.302 ms 1 /classes/Product.php:7546
732
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 44 AND c.`nright` >= 57 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.301 ms 23 /classes/Category.php:1600
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `ps_lang` l
JOIN ps_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.301 ms 1 /classes/Language.php:1216
577
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1699
AND agl.`id_lang` = 1
0.301 ms 2 /classes/Product.php:7546
557
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2180
AND agl.`id_lang` = 1
0.300 ms 1 /classes/Product.php:7546
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM ps_shop_group gs
LEFT JOIN ps_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN ps_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.299 ms 1 Yes /classes/shop/Shop.php:715
561
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1627
AND agl.`id_lang` = 1
0.299 ms 1 /classes/Product.php:7546
936
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 138 AND c.`nright` >= 163 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.299 ms 161 Yes /classes/Category.php:1600
553
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1634
AND agl.`id_lang` = 1
0.298 ms 1 /classes/Product.php:7546
587
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1719
AND agl.`id_lang` = 1
0.298 ms 2 /classes/Product.php:7546
214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1378
AND cp.`id_cart` = 0 AND cp.`id_product` = 1200 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1378
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1200 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.298 ms 0 /classes/Cart.php:1430
197
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 360 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 360 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.297 ms 0 /classes/Cart.php:1430
588
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1721
AND agl.`id_lang` = 1
0.297 ms 2 /classes/Product.php:7546
581
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1707
AND agl.`id_lang` = 1
0.296 ms 2 /classes/Product.php:7546
595
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1735
AND agl.`id_lang` = 1
0.295 ms 2 /classes/Product.php:7546
189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 360
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.295 ms 1 /classes/SpecificPrice.php:259
227
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1201 AND `id_group` = 1 LIMIT 1
0.295 ms 0 /classes/GroupReduction.php:156
316
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 334) AND (b.`id_shop` = 1) LIMIT 1
0.295 ms 1 /src/Adapter/EntityMapper.php:71
542
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2174
AND agl.`id_lang` = 1
0.295 ms 1 /classes/Product.php:7546
555
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2179
AND agl.`id_lang` = 1
0.295 ms 1 /classes/Product.php:7546
559
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2182
AND agl.`id_lang` = 1
0.295 ms 1 /classes/Product.php:7546
571
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1687
AND agl.`id_lang` = 1
0.295 ms 2 /classes/Product.php:7546
572
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1689
AND agl.`id_lang` = 1
0.295 ms 2 /classes/Product.php:7546
593
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1731
AND agl.`id_lang` = 1
0.295 ms 2 /classes/Product.php:7546
611
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1769
AND agl.`id_lang` = 1
0.295 ms 2 /classes/Product.php:7546
736
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 59 AND c.`nright` >= 60 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.295 ms 161 Yes /classes/Category.php:1600
552
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2178
AND agl.`id_lang` = 1
0.294 ms 1 /classes/Product.php:7546
720
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 51 AND c.`nright` >= 52 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.294 ms 27 /classes/Category.php:1600
302
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 333) AND (b.`id_shop` = 1) LIMIT 1
0.293 ms 1 /src/Adapter/EntityMapper.php:71
604
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1755
AND agl.`id_lang` = 1
0.293 ms 2 /classes/Product.php:7546
550
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2176
AND agl.`id_lang` = 1
0.292 ms 1 /classes/Product.php:7546
573
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1691
AND agl.`id_lang` = 1
0.292 ms 2 /classes/Product.php:7546
585
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1715
AND agl.`id_lang` = 1
0.292 ms 2 /classes/Product.php:7546
548
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1647
AND agl.`id_lang` = 1
0.290 ms 1 /classes/Product.php:7546
44
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.289 ms 1 /classes/Category.php:2242
246
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `ps_cart_product` cp
WHERE cp.`id_product_attribute` = 1635
AND cp.`id_cart` = 0 AND cp.`id_product` = 1202 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1635
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1202 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.289 ms 0 /classes/Cart.php:1430
546
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1642
AND agl.`id_lang` = 1
0.289 ms 1 /classes/Product.php:7546
569
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1683
AND agl.`id_lang` = 1
0.289 ms 2 /classes/Product.php:7546
975
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 188 AND c.`nright` >= 189 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.289 ms 161 Yes /classes/Category.php:1600
583
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1711
AND agl.`id_lang` = 1
0.288 ms 2 /classes/Product.php:7546
1015
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 208 AND c.`nright` >= 209 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.288 ms 161 Yes /classes/Category.php:1600
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 360)
0.287 ms 1 /classes/Product.php:3860
549
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1630
AND agl.`id_lang` = 1
0.287 ms 1 /classes/Product.php:7546
575
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1695
AND agl.`id_lang` = 1
0.287 ms 2 /classes/Product.php:7546
576
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1697
AND agl.`id_lang` = 1
0.287 ms 2 /classes/Product.php:7546
591
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1727
AND agl.`id_lang` = 1
0.287 ms 2 /classes/Product.php:7546
223
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1201) AND (b.`id_shop` = 1) LIMIT 1
0.286 ms 1 /src/Adapter/EntityMapper.php:71
609
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1765
AND agl.`id_lang` = 1
0.286 ms 2 /classes/Product.php:7546
82
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "seigicookie" LIMIT 1
0.285 ms 1 /classes/module/Module.php:2664
491
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1388
AND agl.`id_lang` = 1
0.285 ms 2 /classes/Product.php:7546
501
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1202) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
560
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1640
AND agl.`id_lang` = 1
0.285 ms 1 /classes/Product.php:7546
580
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1705
AND agl.`id_lang` = 1
0.285 ms 2 /classes/Product.php:7546
545
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1637
AND agl.`id_lang` = 1
0.285 ms 1 /classes/Product.php:7546
612
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1771
AND agl.`id_lang` = 1
0.284 ms 2 /classes/Product.php:7546
558
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 2181
AND agl.`id_lang` = 1
0.284 ms 1 /classes/Product.php:7546
578
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1701
AND agl.`id_lang` = 1
0.283 ms 2 /classes/Product.php:7546
812
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 99 AND c.`nright` >= 100 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.283 ms 161 Yes /classes/Category.php:1600
824
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 90 AND c.`nright` >= 105 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.283 ms 161 Yes /classes/Category.php:1600
554
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1638
AND agl.`id_lang` = 1
0.282 ms 1 /classes/Product.php:7546
730
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 140 LIMIT 1
0.282 ms 1 /classes/Category.php:1585
556
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1202
AND pac.`id_product_attribute` = 1636
AND agl.`id_lang` = 1
0.281 ms 1 /classes/Product.php:7546
744
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 63 AND c.`nright` >= 64 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.280 ms 161 Yes /classes/Category.php:1600
896
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 141 AND c.`nright` >= 142 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.280 ms 161 Yes /classes/Category.php:1600
568
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1681
AND agl.`id_lang` = 1
0.279 ms 2 /classes/Product.php:7546
840
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 113 AND c.`nright` >= 114 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.279 ms 161 Yes /classes/Category.php:1600
586
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1717
AND agl.`id_lang` = 1
0.278 ms 2 /classes/Product.php:7546
332
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 335
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.277 ms 1 /classes/SpecificPrice.php:259
582
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1709
AND agl.`id_lang` = 1
0.277 ms 2 /classes/Product.php:7546
983
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 192 AND c.`nright` >= 193 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.277 ms 161 Yes /classes/Category.php:1600
492
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1390
AND agl.`id_lang` = 1
0.277 ms 2 /classes/Product.php:7546
589
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1723
AND agl.`id_lang` = 1
0.276 ms 2 /classes/Product.php:7546
607
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1761
AND agl.`id_lang` = 1
0.276 ms 2 /classes/Product.php:7546
664
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 19 AND c.`nright` >= 20 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.276 ms 11 /classes/Category.php:1600
904
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 145 AND c.`nright` >= 146 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.276 ms 161 Yes /classes/Category.php:1600
232
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1201
ORDER BY f.position ASC
0.276 ms 1 Yes /classes/Product.php:6032
495
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1396
AND agl.`id_lang` = 1
0.276 ms 2 /classes/Product.php:7546
596
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1739
AND agl.`id_lang` = 1
0.276 ms 2 /classes/Product.php:7546
235
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1202) AND (b.`id_shop` = 1) LIMIT 1
0.275 ms 1 /src/Adapter/EntityMapper.php:71
291
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 332)
0.275 ms 1 /classes/Product.php:3860
590
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1725
AND agl.`id_lang` = 1
0.275 ms 2 /classes/Product.php:7546
608
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1763
AND agl.`id_lang` = 1
0.275 ms 2 /classes/Product.php:7546
610
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1767
AND agl.`id_lang` = 1
0.275 ms 2 /classes/Product.php:7546
748
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 65 AND c.`nright` >= 66 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.275 ms 161 Yes /classes/Category.php:1600
924
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 155 AND c.`nright` >= 156 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.275 ms 161 Yes /classes/Category.php:1600
598
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1743
AND agl.`id_lang` = 1
0.274 ms 2 /classes/Product.php:7546
603
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1753
AND agl.`id_lang` = 1
0.274 ms 2 /classes/Product.php:7546
605
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1757
AND agl.`id_lang` = 1
0.274 ms 2 /classes/Product.php:7546
494
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1394
AND agl.`id_lang` = 1
0.273 ms 2 /classes/Product.php:7546
592
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1729
AND agl.`id_lang` = 1
0.273 ms 2 /classes/Product.php:7546
594
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1733
AND agl.`id_lang` = 1
0.273 ms 2 /classes/Product.php:7546
908
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 147 AND c.`nright` >= 148 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.273 ms 161 Yes /classes/Category.php:1600
600
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1747
AND agl.`id_lang` = 1
0.272 ms 2 /classes/Product.php:7546
601
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1749
AND agl.`id_lang` = 1
0.272 ms 2 /classes/Product.php:7546
764
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 75 AND c.`nright` >= 76 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.272 ms 161 Yes /classes/Category.php:1600
900
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 143 AND c.`nright` >= 144 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.272 ms 161 Yes /classes/Category.php:1600
1023
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 182 AND c.`nright` >= 211 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.272 ms 161 Yes /classes/Category.php:1600
912
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 149 AND c.`nright` >= 150 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.271 ms 161 Yes /classes/Category.php:1600
1019
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 199 AND c.`nright` >= 210 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.271 ms 161 Yes /classes/Category.php:1600
584
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1713
AND agl.`id_lang` = 1
0.271 ms 2 /classes/Product.php:7546
920
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 153 AND c.`nright` >= 154 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.271 ms 161 Yes /classes/Category.php:1600
644
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 9 AND c.`nright` >= 10 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.270 ms 6 /classes/Category.php:1600
597
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1741
AND agl.`id_lang` = 1
0.270 ms 2 /classes/Product.php:7546
832
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 109 AND c.`nright` >= 110 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.270 ms 161 Yes /classes/Category.php:1600
979
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 190 AND c.`nright` >= 191 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.270 ms 161 Yes /classes/Category.php:1600
828
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 107 AND c.`nright` >= 108 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.269 ms 161 Yes /classes/Category.php:1600
579
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1703
AND agl.`id_lang` = 1
0.269 ms 2 /classes/Product.php:7546
599
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1745
AND agl.`id_lang` = 1
0.269 ms 2 /classes/Product.php:7546
760
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 71 AND c.`nright` >= 72 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.269 ms 161 Yes /classes/Category.php:1600
995
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 185 AND c.`nright` >= 198 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.269 ms 161 Yes /classes/Category.php:1600
1051
SELECT SQL_NO_CACHE al.`name` AS attribute_name
FROM `ps_product_attribute_combination` pac
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (
a.`id_attribute` = al.`id_attribute`
AND al.`id_lang` = 1
)
WHERE pac.`id_product_attribute` = 1378
ORDER BY ag.`position` ASC, a.`position` ASC
0.269 ms 2 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:241
844
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 115 AND c.`nright` >= 116 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.268 ms 161 Yes /classes/Category.php:1600
971
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 186 AND c.`nright` >= 187 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.268 ms 161 Yes /classes/Category.php:1600
363
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 354
0.267 ms 1 /classes/Product.php:2902
497
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1400
AND agl.`id_lang` = 1
0.267 ms 2 /classes/Product.php:7546
948
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 164 AND c.`nright` >= 173 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.267 ms 161 Yes /classes/Category.php:1600
1007
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 204 AND c.`nright` >= 205 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.267 ms 161 Yes /classes/Category.php:1600
496
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1398
AND agl.`id_lang` = 1
0.267 ms 2 /classes/Product.php:7546
304
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 333
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.266 ms 1 /classes/SpecificPrice.php:259
366
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 358
ORDER BY `position`
0.266 ms 1 Yes /classes/Product.php:3545
804
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 95 AND c.`nright` >= 96 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.266 ms 161 Yes /classes/Category.php:1600
808
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 97 AND c.`nright` >= 98 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.266 ms 161 Yes /classes/Category.php:1600
836
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 111 AND c.`nright` >= 112 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.265 ms 161 Yes /classes/Category.php:1600
944
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 167 AND c.`nright` >= 168 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.265 ms 161 Yes /classes/Category.php:1600
999
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 200 AND c.`nright` >= 201 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.265 ms 161 Yes /classes/Category.php:1600
1011
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 206 AND c.`nright` >= 207 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.265 ms 161 Yes /classes/Category.php:1600
58
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 181 AND c.`nright` >= 214 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.264 ms 161 Yes /classes/Category.php:1600
820
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 103 AND c.`nright` >= 104 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.264 ms 161 Yes /classes/Category.php:1600
668
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 21 AND c.`nright` >= 22 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.263 ms 12 /classes/Category.php:1600
932
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 161 AND c.`nright` >= 162 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.263 ms 161 Yes /classes/Category.php:1600
129
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 353) AND (b.`id_shop` = 1) LIMIT 1
0.262 ms 1 /src/Adapter/EntityMapper.php:71
306
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 333)
0.262 ms 1 /classes/Product.php:3860
493
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1392
AND agl.`id_lang` = 1
0.262 ms 2 /classes/Product.php:7546
956
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 175 AND c.`nright` >= 178 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.262 ms 161 Yes /classes/Category.php:1600
967
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 183 AND c.`nright` >= 184 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.262 ms 161 Yes /classes/Category.php:1600
848
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 117 AND c.`nright` >= 118 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.262 ms 161 Yes /classes/Category.php:1600
752
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 67 AND c.`nright` >= 68 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.261 ms 161 Yes /classes/Category.php:1600
498
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1200
AND pac.`id_product_attribute` = 1402
AND agl.`id_lang` = 1
0.260 ms 2 /classes/Product.php:7546
606
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `ps_attribute` a
LEFT JOIN `ps_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1)
LEFT JOIN `ps_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `ps_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1)
LEFT JOIN `ps_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1)
WHERE pa.`id_product` = 1205
AND pac.`id_product_attribute` = 1759
AND agl.`id_lang` = 1
0.260 ms 2 /classes/Product.php:7546
928
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 159 AND c.`nright` >= 160 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.260 ms 161 Yes /classes/Category.php:1600
143
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 354) AND (b.`id_shop` = 1) LIMIT 1
0.260 ms 1 /src/Adapter/EntityMapper.php:71
264
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1203
ORDER BY f.position ASC
0.260 ms 1 Yes /classes/Product.php:6032
756
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 69 AND c.`nright` >= 70 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.260 ms 161 Yes /classes/Category.php:1600
916
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 151 AND c.`nright` >= 152 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.260 ms 161 Yes /classes/Category.php:1600
740
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 61 AND c.`nright` >= 62 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.259 ms 161 Yes /classes/Category.php:1600
888
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 136 AND c.`nright` >= 137 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.258 ms 161 Yes /classes/Category.php:1600
952
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 176 AND c.`nright` >= 177 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.258 ms 161 Yes /classes/Category.php:1600
987
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 194 AND c.`nright` >= 195 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.257 ms 161 Yes /classes/Category.php:1600
1027
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 212 AND c.`nright` >= 213 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.257 ms 161 Yes /classes/Category.php:1600
672
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 23 AND c.`nright` >= 24 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.256 ms 13 /classes/Category.php:1600
436
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-addons' LIMIT 1
0.255 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
960
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 174 AND c.`nright` >= 179 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.255 ms 161 Yes /classes/Category.php:1600
424
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.253 ms 1 /classes/module/Module.php:2664
800
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 93 AND c.`nright` >= 94 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.253 ms 161 Yes /classes/Category.php:1600
991
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 196 AND c.`nright` >= 197 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.253 ms 161 Yes /classes/Category.php:1600
86
SELECT SQL_NO_CACHE `active`
FROM `ps_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.253 ms 1 /modules/ps_mbo/ps_mbo.php:329
198
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 360
ORDER BY f.position ASC
0.252 ms 1 Yes /classes/Product.php:6032
648
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 11 AND c.`nright` >= 12 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.251 ms 7 /classes/Category.php:1600
692
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 29 AND c.`nright` >= 34 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.250 ms 16 /classes/Category.php:1600
1030
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 181 AND c.`nright` >= 214 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.250 ms 161 Yes /classes/Category.php:1600
206
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1200)
0.249 ms 26 /classes/Product.php:3860
788
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 87 AND c.`nright` >= 88 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.249 ms 161 Yes /classes/Category.php:1600
187
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 360) AND (b.`id_shop` = 1) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
280
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1205
ORDER BY f.position ASC
0.248 ms 1 Yes /classes/Product.php:6032
352
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 336 LIMIT 1
0.248 ms 1 /classes/Pack.php:90
796
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 91 AND c.`nright` >= 92 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.248 ms 161 Yes /classes/Category.php:1600
635
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.247 ms 1 /classes/Category.php:1591
652
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 13 AND c.`nright` >= 14 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.247 ms 8 /classes/Category.php:1600
780
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 83 AND c.`nright` >= 84 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.247 ms 161 Yes /classes/Category.php:1600
247
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1202 AND pa.`id_product` = 1202 AND pa.`id_product_attribute` = 1635 LIMIT 1
0.246 ms 1 /classes/Product.php:1209
784
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 85 AND c.`nright` >= 86 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.246 ms 161 Yes /classes/Category.php:1600
95
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
158
SELECT SQL_NO_CACHE *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 357) AND (b.`id_shop` = 1) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
880
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 133 AND c.`nright` >= 134 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.245 ms 161 Yes /classes/Category.php:1600
184
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 358
ORDER BY f.position ASC
0.241 ms 1 Yes /classes/Product.php:6032
216
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1200
ORDER BY f.position ASC
0.241 ms 1 Yes /classes/Product.php:6032
113
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 351)
0.240 ms 1 /classes/Product.php:3860
47
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 321 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.239 ms 1 Yes /classes/Category.php:1600
856
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 121 AND c.`nright` >= 122 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.238 ms 161 Yes /classes/Category.php:1600
860
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 123 AND c.`nright` >= 124 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.237 ms 161 Yes /classes/Category.php:1600
884
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 106 AND c.`nright` >= 135 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.237 ms 161 Yes /classes/Category.php:1600
154
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 354
ORDER BY f.position ASC
0.235 ms 1 Yes /classes/Product.php:6032
80
SELECT SQL_NO_CACHE * FROM `ps_cart_rule` cr
LEFT JOIN `ps_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.235 ms 1 /classes/CartRule.php:423
792
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 58 AND c.`nright` >= 89 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.235 ms 161 Yes /classes/Category.php:1600
238
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1202)
0.234 ms 28 /classes/Product.php:3860
337
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 335 LIMIT 1
0.234 ms 1 /classes/Pack.php:89
360
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 353
ORDER BY `position`
0.234 ms 1 Yes /classes/Product.php:3545
169
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM ps_feature_product pf
LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN ps_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 357
ORDER BY f.position ASC
0.233 ms 1 Yes /classes/Product.php:6032
243
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1203
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 3 /classes/Product.php:3570
665
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 109) AND (b.`id_shop` = 1) LIMIT 1
0.231 ms 1 /src/Adapter/EntityMapper.php:71
741
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 163) AND (b.`id_shop` = 1) LIMIT 1
0.231 ms 1 /src/Adapter/EntityMapper.php:71
369
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 360
0.229 ms 1 /classes/Product.php:2902
700
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 37 AND c.`nright` >= 38 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.229 ms 20 /classes/Category.php:1600
265
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1205
AND image_shop.`cover` = 1 LIMIT 1
0.229 ms 54 /classes/Product.php:3570
310
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 333 LIMIT 1
0.229 ms 1 /classes/Pack.php:90
708
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 41 AND c.`nright` >= 42 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.227 ms 22 /classes/Category.php:1600
1034
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 276 AND c.`nright` >= 277 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.227 ms 24 Yes /classes/Category.php:1600
7
SELECT SQL_NO_CACHE *
FROM `ps_country` a
LEFT JOIN `ps_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.226 ms 1 /src/Adapter/EntityMapper.php:71
79
SELECT SQL_NO_CACHE 1 FROM `ps_cart_rule` WHERE ((date_to >= "2025-12-23 00:00:00" AND date_to <= "2025-12-23 23:59:59") OR (date_from >= "2025-12-23 00:00:00" AND date_from <= "2025-12-23 23:59:59") OR (date_from < "2025-12-23 00:00:00" AND date_to > "2025-12-23 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.226 ms 1 /classes/CartRule.php:357
141
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 354
AND image_shop.`cover` = 1 LIMIT 1
0.226 ms 1 /classes/Product.php:3570
338
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 335 LIMIT 1
0.226 ms 1 /classes/Pack.php:90
386
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 333
0.225 ms 1 /classes/Product.php:2902
397
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-addons' LIMIT 1
0.225 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
716
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 47 AND c.`nright` >= 48 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.224 ms 25 /classes/Category.php:1600
92
SELECT SQL_NO_CACHE `id_category`
FROM `ps_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.224 ms 1 /classes/Category.php:2450
696
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 35 AND c.`nright` >= 36 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.223 ms 19 /classes/Category.php:1600
901
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 243) AND (b.`id_shop` = 1) LIMIT 1
0.223 ms 1 /src/Adapter/EntityMapper.php:71
893
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 241) AND (b.`id_shop` = 1) LIMIT 1
0.222 ms 1 /src/Adapter/EntityMapper.php:71
162
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 357)
0.220 ms 1 /classes/Product.php:3860
362
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 354
ORDER BY `position`
0.220 ms 1 Yes /classes/Product.php:3545
724
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 53 AND c.`nright` >= 54 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.219 ms 28 /classes/Category.php:1600
728
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 55 AND c.`nright` >= 56 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.219 ms 29 /classes/Category.php:1600
801
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 183) AND (b.`id_shop` = 1) LIMIT 1
0.219 ms 1 /src/Adapter/EntityMapper.php:71
773
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 172) AND (b.`id_shop` = 1) LIMIT 1
0.216 ms 1 /src/Adapter/EntityMapper.php:71
1037
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 275 AND c.`nright` >= 292 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.216 ms 16 Yes /classes/Category.php:1600
1052
SELECT SQL_NO_CACHE al.`name` AS attribute_name
FROM `ps_product_attribute_combination` pac
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (
a.`id_attribute` = al.`id_attribute`
AND al.`id_lang` = 1
)
WHERE pac.`id_product_attribute` = 1635
ORDER BY ag.`position` ASC, a.`position` ASC
0.216 ms 1 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:241
437
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-whiteboard-addon' LIMIT 1
0.215 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
653
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 106) AND (b.`id_shop` = 1) LIMIT 1
0.215 ms 1 /src/Adapter/EntityMapper.php:71
688
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 32 AND c.`nright` >= 33 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.215 ms 18 /classes/Category.php:1600
222
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 282 LIMIT 1
0.214 ms 1 /classes/Product.php:5670
769
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 171) AND (b.`id_shop` = 1) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
54
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 3 AND c.`nright` >= 180 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.212 ms 2 /classes/Category.php:1600
78
SELECT SQL_NO_CACHE 1 FROM ps_cart_product cp INNER JOIN ps_product p
ON (p.id_product = cp.id_product) INNER JOIN ps_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.212 ms 1 /classes/Cart.php:4256
632
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 321 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.212 ms 1 Yes /classes/Category.php:1600
640
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 7 AND c.`nright` >= 8 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.212 ms 5 /classes/Category.php:1600
704
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 39 AND c.`nright` >= 40 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.212 ms 21 /classes/Category.php:1600
733
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 161) AND (b.`id_shop` = 1) LIMIT 1
0.211 ms 1 /src/Adapter/EntityMapper.php:71
656
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 15 AND c.`nright` >= 16 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.210 ms 9 /classes/Category.php:1600
669
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 121) AND (b.`id_shop` = 1) LIMIT 1
0.210 ms 1 /src/Adapter/EntityMapper.php:71
684
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 30 AND c.`nright` >= 31 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.209 ms 17 /classes/Category.php:1600
873
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 213) AND (b.`id_shop` = 1) LIMIT 1
0.208 ms 1 /src/Adapter/EntityMapper.php:71
676
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 25 AND c.`nright` >= 26 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.206 ms 14 /classes/Category.php:1600
649
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 105) AND (b.`id_shop` = 1) LIMIT 1
0.205 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1202
AND image_shop.`cover` = 1 LIMIT 1
0.205 ms 29 /classes/Product.php:3570
199
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1200
AND image_shop.`cover` = 1 LIMIT 1
0.204 ms 16 /classes/Product.php:3570
645
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 104) AND (b.`id_shop` = 1) LIMIT 1
0.203 ms 1 /src/Adapter/EntityMapper.php:71
1053
SELECT SQL_NO_CACHE al.`name` AS attribute_name
FROM `ps_product_attribute_combination` pac
LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `ps_attribute_lang` al ON (
a.`id_attribute` = al.`id_attribute`
AND al.`id_lang` = 1
)
WHERE pac.`id_product_attribute` = 1737
ORDER BY ag.`position` ASC, a.`position` ASC
0.202 ms 2 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:241
273
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 1205 LIMIT 1
0.202 ms 1 /classes/Pack.php:89
697
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 131) AND (b.`id_shop` = 1) LIMIT 1
0.201 ms 1 /src/Adapter/EntityMapper.php:71
712
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 4 AND c.`nright` >= 43 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.201 ms 3 /classes/Category.php:1600
753
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 166) AND (b.`id_shop` = 1) LIMIT 1
0.201 ms 1 /src/Adapter/EntityMapper.php:71
865
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 209) AND (b.`id_shop` = 1) LIMIT 1
0.200 ms 1 /src/Adapter/EntityMapper.php:71
833
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 202) AND (b.`id_shop` = 1) LIMIT 1
0.198 ms 1 /src/Adapter/EntityMapper.php:71
96
SELECT SQL_NO_CACHE *
FROM `ps_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.197 ms 3 /src/Adapter/EntityMapper.php:79
299
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `ps_image` i
INNER JOIN ps_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 333
AND image_shop.`cover` = 1 LIMIT 1
0.197 ms 4 /classes/Product.php:3570
869
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 212) AND (b.`id_shop` = 1) LIMIT 1
0.197 ms 1 /src/Adapter/EntityMapper.php:71
941
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 282) AND (b.`id_shop` = 1) LIMIT 1
0.197 ms 1 /src/Adapter/EntityMapper.php:71
67
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 321 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.196 ms 1 Yes /classes/Category.php:1600
8
SELECT SQL_NO_CACHE *
FROM `ps_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.195 ms 1 /src/Adapter/EntityMapper.php:71
29
SELECT SQL_NO_CACHE *
FROM `ps_currency` a
LEFT JOIN `ps_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.195 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1201)
0.195 ms 1 /classes/Product.php:3860
637
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 102) AND (b.`id_shop` = 1) LIMIT 1
0.195 ms 1 /src/Adapter/EntityMapper.php:71
680
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 27 AND c.`nright` >= 28 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.195 ms 15 /classes/Category.php:1600
963
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 3 AND c.`nright` >= 180 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.195 ms 2 /classes/Category.php:1600
1041
SELECT SQL_NO_CACHE *
FROM `ps_simpleblog_category` c
LEFT JOIN `ps_simpleblog_category_lang` cl ON (c.`id_simpleblog_category` = cl.`id_simpleblog_category` AND cl.`id_lang` = 1)
WHERE 1=1
AND c.`active` = 1
AND c.`id_parent` = 0
ORDER BY c.position ASC
0.194 ms 1 Yes /modules/ph_simpleblog/models/SimpleBlogCategory.php:362
777
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 173) AND (b.`id_shop` = 1) LIMIT 1
0.194 ms 1 /src/Adapter/EntityMapper.php:71
660
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 17 AND c.`nright` >= 18 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.193 ms 10 /classes/Category.php:1600
75
SELECT SQL_NO_CACHE *
FROM `ps_category` a0
LEFT JOIN `ps_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 321) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.192 ms 1 Yes /classes/PrestaShopCollection.php:383
396
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_orders` o
LEFT JOIN `ps_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
0.192 ms 1 /classes/order/Order.php:881
62
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 275 AND c.`nright` >= 292 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.192 ms 16 Yes /classes/Category.php:1600
877
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 214) AND (b.`id_shop` = 1) LIMIT 1
0.191 ms 1 /src/Adapter/EntityMapper.php:71
147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 354)
0.190 ms 1 /classes/Product.php:3860
701
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 110) AND (b.`id_shop` = 1) LIMIT 1
0.190 ms 1 /src/Adapter/EntityMapper.php:71
399
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-backup-addon' LIMIT 1
0.189 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
406
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-slicey-addon' LIMIT 1
0.189 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
913
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 246) AND (b.`id_shop` = 1) LIMIT 1
0.189 ms 1 /src/Adapter/EntityMapper.php:71
657
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 107) AND (b.`id_shop` = 1) LIMIT 1
0.188 ms 1 /src/Adapter/EntityMapper.php:71
677
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 123) AND (b.`id_shop` = 1) LIMIT 1
0.188 ms 1 /src/Adapter/EntityMapper.php:71
761
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 169) AND (b.`id_shop` = 1) LIMIT 1
0.187 ms 1 /src/Adapter/EntityMapper.php:71
633
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 101) AND (b.`id_shop` = 1) LIMIT 1
0.187 ms 1 /src/Adapter/EntityMapper.php:71
972
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 512) AND (b.`id_shop` = 1) LIMIT 1
0.187 ms 1 /src/Adapter/EntityMapper.php:71
89
SELECT SQL_NO_CACHE * FROM ps_hook_module
WHERE `id_hook` = 1037
AND `id_module` = 196
AND `id_shop` = 1
0.185 ms 1 /classes/Hook.php:518
905
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 244) AND (b.`id_shop` = 1) LIMIT 1
0.185 ms 1 /src/Adapter/EntityMapper.php:71
909
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 245) AND (b.`id_shop` = 1) LIMIT 1
0.184 ms 1 /src/Adapter/EntityMapper.php:71
925
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 250) AND (b.`id_shop` = 1) LIMIT 1
0.183 ms 1 /src/Adapter/EntityMapper.php:71
417
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-domain-switch-addon' LIMIT 1
0.182 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
1040
SELECT SQL_NO_CACHE c.*, cl.*  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 2 AND c.`nright` >= 321 AND c.`nleft` >= 2 AND c.`nright` <= 321 ORDER BY `nleft` DESC
0.181 ms 1 Yes /classes/Category.php:1600
502
SELECT SQL_NO_CACHE *
FROM `ps_product_lang`
WHERE `id_product` = 1202 AND `id_shop` = 1
0.180 ms 1 /src/Adapter/EntityMapper.php:79
24
SELECT SQL_NO_CACHE c.`id_category` FROM `ps_category_lang` cl
INNER JOIN `ps_category` c ON (c.id_category = cl.id_category)
INNER JOIN `ps_category_shop` cs ON (c.id_category = cs.id_category)
WHERE 1 AND cs.id_shop=1 AND cl.`link_rewrite` = 'inicio' AND cl.`id_lang` = 1 LIMIT 1
0.178 ms 161 /override/controllers/front/listing/CategoryController.php:86
336
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 335 AND `id_group` = 1 LIMIT 1
0.178 ms 0 /classes/GroupReduction.php:156
897
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 242) AND (b.`id_shop` = 1) LIMIT 1
0.178 ms 1 /src/Adapter/EntityMapper.php:71
224
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 1201 LIMIT 1
0.178 ms 1 /classes/SpecificPrice.php:435
757
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 167) AND (b.`id_shop` = 1) LIMIT 1
0.177 ms 1 /src/Adapter/EntityMapper.php:71
725
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 146) AND (b.`id_shop` = 1) LIMIT 1
0.177 ms 1 /src/Adapter/EntityMapper.php:71
26
SELECT SQL_NO_CACHE * FROM `ps_currency` c ORDER BY `iso_code` ASC
0.176 ms 2 Yes /classes/Currency.php:709
81
SELECT SQL_NO_CACHE * FROM ps_revslider_sliders
0.176 ms 3 /modules/revsliderprestashop/includes/revslider_db.class.php:214
821
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 180) AND (b.`id_shop` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
976
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 513) AND (b.`id_shop` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
984
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 515) AND (b.`id_shop` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
90
SELECT SQL_NO_CACHE *
FROM `ps_shop_url` a0
0.175 ms 1 /classes/PrestaShopCollection.php:383
499
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 1201
0.175 ms 3 /classes/Product.php:3423
737
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 162) AND (b.`id_shop` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
829
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 210) AND (b.`id_shop` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
996
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 521) AND (b.`id_shop` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
9
SELECT SQL_NO_CACHE *
FROM `ps_lang` a
LEFT JOIN `ps_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
325
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:453
426
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `ps_currency` c
LEFT JOIN ps_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.174 ms 2 /classes/Currency.php:1136
805
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 184) AND (b.`id_shop` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
885
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 220) AND (b.`id_shop` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
921
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 248) AND (b.`id_shop` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
1016
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 520) AND (b.`id_shop` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
25
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
215
SELECT SQL_NO_CACHE pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1200 AND pa.`id_product` = 1200 AND pa.`id_product_attribute` = 1378 LIMIT 1
0.173 ms 1 /classes/Product.php:1209
825
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 201) AND (b.`id_shop` = 1) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
837
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 203) AND (b.`id_shop` = 1) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
3
SELECT SQL_NO_CACHE value FROM `ps_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.172 ms 1 /classes/shop/Shop.php:1183
937
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 281) AND (b.`id_shop` = 1) LIMIT 1
0.172 ms 1 /src/Adapter/EntityMapper.php:71
938
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 281 LIMIT 1
0.172 ms 1 /classes/Category.php:1585
964
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 501) AND (b.`id_shop` = 1) LIMIT 1
0.172 ms 1 /src/Adapter/EntityMapper.php:71
1020
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 500) AND (b.`id_shop` = 1) LIMIT 1
0.172 ms 1 /src/Adapter/EntityMapper.php:71
673
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 122) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
721
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 145) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
745
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 164) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
789
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 160) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
817
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 187) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
87
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `ps_module` m
LEFT JOIN `ps_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.170 ms 1 /modules/ps_mbo/ps_mbo.php:339
367
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 358
0.170 ms 1 /classes/Product.php:2902
398
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-whiteboard-addon' LIMIT 1
0.170 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
705
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 111) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
845
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 211) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
945
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 280) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
953
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1201) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
980
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 514) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
988
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 516) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
1004
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 524) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
641
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 103) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
849
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 205) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
957
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1200) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
968
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 511) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
992
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 510) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
1000
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 523) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
685
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 126) AND (b.`id_shop` = 1) LIMIT 1
0.168 ms 1 /src/Adapter/EntityMapper.php:71
917
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 247) AND (b.`id_shop` = 1) LIMIT 1
0.168 ms 1 /src/Adapter/EntityMapper.php:71
1024
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 530) AND (b.`id_shop` = 1) LIMIT 1
0.168 ms 1 /src/Adapter/EntityMapper.php:71
438
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-backup-addon' LIMIT 1
0.167 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
466
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.167 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
713
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 142) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
1012
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 526) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
435
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `ps_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.167 ms 1 /classes/Cart.php:1303
749
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 165) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
813
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 186) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
929
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 252) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
933
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 240) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
1008
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 525) AND (b.`id_shop` = 1) LIMIT 1
0.167 ms 1 /src/Adapter/EntityMapper.php:71
881
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 200) AND (b.`id_shop` = 1) LIMIT 1
0.166 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 10) AND (b.`id_shop` = 1) LIMIT 1
0.166 ms 1 /src/Adapter/EntityMapper.php:71
889
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 251) AND (b.`id_shop` = 1) LIMIT 1
0.166 ms 1 /src/Adapter/EntityMapper.php:71
98
SELECT SQL_NO_CACHE data FROM ps_layered_filter_block WHERE hash="748a8fd97c48b405ce4416e7ad26af9e" LIMIT 1
0.165 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
693
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 130) AND (b.`id_shop` = 1) LIMIT 1
0.165 ms 1 /src/Adapter/EntityMapper.php:71
774
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 172 LIMIT 1
0.165 ms 1 /classes/Category.php:1585
853
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 206) AND (b.`id_shop` = 1) LIMIT 1
0.165 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1737) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
374
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1201
0.164 ms 1 /classes/Product.php:2902
765
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 170) AND (b.`id_shop` = 1) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
870
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 212 LIMIT 1
0.164 ms 1 /classes/Category.php:1585
841
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 204) AND (b.`id_shop` = 1) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
475
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 353
0.163 ms 3 /classes/Product.php:3423
1035
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 56 LIMIT 1
0.163 ms 1 /classes/Category.php:1585
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `ps_lang` l
LEFT JOIN `ps_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.162 ms 1 /classes/Language.php:1080
439
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-typewriter-addon' LIMIT 1
0.162 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
661
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 108) AND (b.`id_shop` = 1) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
250
SELECT SQL_NO_CACHE *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1635) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
315
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 201 LIMIT 1
0.162 ms 1 /classes/Product.php:5670
793
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 181) AND (b.`id_shop` = 1) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
949
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1202) AND (b.`id_shop` = 1) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
717
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 144) AND (b.`id_shop` = 1) LIMIT 1
0.161 ms 1 /src/Adapter/EntityMapper.php:71
766
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 170 LIMIT 1
0.161 ms 1 /classes/Category.php:1585
689
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 124) AND (b.`id_shop` = 1) LIMIT 1
0.161 ms 1 /src/Adapter/EntityMapper.php:71
770
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 171 LIMIT 1
0.161 ms 1 /classes/Category.php:1585
1031
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1004) AND (b.`id_shop` = 1) LIMIT 1
0.161 ms 1 /src/Adapter/EntityMapper.php:71
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM ps_shop s
LEFT JOIN ps_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.160 ms 1 /classes/shop/Shop.php:218
339
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 335) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:453
630
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.160 ms 1 /classes/Category.php:1585
709
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 100) AND (b.`id_shop` = 1) LIMIT 1
0.160 ms 1 /src/Adapter/EntityMapper.php:71
969
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 511 LIMIT 1
0.160 ms 1 /classes/Category.php:1585
654
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 106 LIMIT 1
0.159 ms 1 /classes/Category.php:1585
797
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 182) AND (b.`id_shop` = 1) LIMIT 1
0.159 ms 1 /src/Adapter/EntityMapper.php:71
463
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.159 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
850
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 205 LIMIT 1
0.158 ms 1 /classes/Category.php:1585
268
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1737 LIMIT 1
0.157 ms 1 /classes/Combination.php:564
809
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 185) AND (b.`id_shop` = 1) LIMIT 1
0.157 ms 1 /src/Adapter/EntityMapper.php:71
861
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 208) AND (b.`id_shop` = 1) LIMIT 1
0.157 ms 1 /src/Adapter/EntityMapper.php:71
781
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 175) AND (b.`id_shop` = 1) LIMIT 1
0.156 ms 1 /src/Adapter/EntityMapper.php:71
642
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 103 LIMIT 1
0.156 ms 1 /classes/Category.php:1585
785
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 176) AND (b.`id_shop` = 1) LIMIT 1
0.156 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM ps_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.155 ms 1 /classes/shop/ShopUrl.php:182
204
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1378 LIMIT 1
0.155 ms 1 /classes/Combination.php:564
878
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 214 LIMIT 1
0.155 ms 1 /classes/Category.php:1585
670
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 121 LIMIT 1
0.154 ms 1 /classes/Category.php:1585
857
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 207) AND (b.`id_shop` = 1) LIMIT 1
0.154 ms 1 /src/Adapter/EntityMapper.php:71
121
SELECT SQL_NO_CACHE tr.*
FROM `ps_tax_rule` tr
JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.153 ms 0 /classes/tax/TaxRulesTaxManager.php:109
440
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-maintenance-addon' LIMIT 1
0.153 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
646
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 104 LIMIT 1
0.153 ms 1 /classes/Category.php:1585
894
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 241 LIMIT 1
0.153 ms 1 /classes/Category.php:1585
1013
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 526 LIMIT 1
0.153 ms 1 /classes/Category.php:1585
666
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 109 LIMIT 1
0.153 ms 1 /classes/Category.php:1585
10
SELECT SQL_NO_CACHE id_shop
FROM `ps_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.152 ms 1 /classes/ObjectModel.php:1732
464
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.152 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
55
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 15) AND (b.`id_shop` = 1) LIMIT 1
0.152 ms 1 /src/Adapter/EntityMapper.php:71
345
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 336 LIMIT 1
0.152 ms 10 /classes/SpecificPrice.php:435
442
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-particles-addon' LIMIT 1
0.152 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
681
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 125) AND (b.`id_shop` = 1) LIMIT 1
0.152 ms 1 /src/Adapter/EntityMapper.php:71
718
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 144 LIMIT 1
0.152 ms 1 /classes/Category.php:1585
462
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.151 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
650
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 105 LIMIT 1
0.151 ms 1 /classes/Category.php:1585
446
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-beforeafter-addon' LIMIT 1
0.150 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
450
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-revealer-addon' LIMIT 1
0.150 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
479
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 357
0.150 ms 4 /classes/Product.php:3423
483
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 360
0.150 ms 3 /classes/Product.php:3423
1042
SELECT SQL_NO_CACHE *
FROM `ps_simpleblog_category` sbc
LEFT JOIN `ps_simpleblog_category_lang` sbcl
ON (sbc.`id_simpleblog_category` = sbcl.`id_simpleblog_category` AND sbcl.`id_lang` = 1)
WHERE sbc.`id_parent` = 1 AND sbc.active = 1
ORDER BY sbc.`position` ASC
0.150 ms 1 Yes /modules/ph_simpleblog/models/SimpleBlogCategory.php:203
400
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-typewriter-addon' LIMIT 1
0.149 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
420
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.149 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
866
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 209 LIMIT 1
0.149 ms 1 /classes/Category.php:1585
922
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 248 LIMIT 1
0.149 ms 1 /classes/Category.php:1585
59
SELECT SQL_NO_CACHE *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) AND (b.`id_shop` = 1) LIMIT 1
0.148 ms 1 /src/Adapter/EntityMapper.php:71
101
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 241 LIMIT 1
0.148 ms 1 /classes/Category.php:1378
303
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 333 LIMIT 1
0.148 ms 10 /classes/SpecificPrice.php:435
946
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 280 LIMIT 1
0.148 ms 1 /classes/Category.php:1585
408
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-weather-addon' LIMIT 1
0.148 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
226
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1201 AND id_shop=1 LIMIT 1
0.147 ms 1 /classes/Product.php:6887
401
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-maintenance-addon' LIMIT 1
0.146 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
459
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.146 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
477
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 354
0.146 ms 3 /classes/Product.php:3423
485
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 1200
0.146 ms 3 /classes/Product.php:3423
615
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 332
0.145 ms 4 /classes/Product.php:3423
68
SELECT SQL_NO_CACHE * FROM `ps_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.145 ms 8 Yes /classes/ImageType.php:109
236
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `ps_product_attribute` pa
INNER JOIN ps_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1635 LIMIT 1
0.145 ms 1 /classes/Combination.php:564
376
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1202
0.145 ms 28 /classes/Product.php:2902
407
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-beforeafter-addon' LIMIT 1
0.145 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
778
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 173 LIMIT 1
0.145 ms 1 /classes/Category.php:1585
271
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1205 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6887
445
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-slicey-addon' LIMIT 1
0.144 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
452
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-bubblemorph-addon' LIMIT 1
0.144 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
465
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.144 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
750
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 165 LIMIT 1
0.144 ms 1 /classes/Category.php:1585
617
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 333
0.143 ms 3 /classes/Product.php:3423
914
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 246 LIMIT 1
0.143 ms 1 /classes/Category.php:1585
1017
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 520 LIMIT 1
0.143 ms 1 /classes/Category.php:1585
443
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-polyfold-addon' LIMIT 1
0.142 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
506
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1627) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
562
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 1203
0.142 ms 3 /classes/Product.php:3423
898
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 242 LIMIT 1
0.142 ms 1 /classes/Category.php:1585
818
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 187 LIMIT 1
0.141 ms 1 /classes/Category.php:1585
902
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 243 LIMIT 1
0.141 ms 1 /classes/Category.php:1585
431
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.141 ms 1 /classes/module/Module.php:2664
662
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 108 LIMIT 1
0.141 ms 1 /classes/Category.php:1585
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `ps_hook_alias`
0.140 ms 88 /classes/Hook.php:290
481
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 358
0.140 ms 3 /classes/Product.php:3423
734
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 161 LIMIT 1
0.140 ms 1 /classes/Category.php:1585
72
SELECT SQL_NO_CACHE *
FROM `ps_country` a
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.140 ms 1 /src/Adapter/EntityMapper.php:71
262
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1203) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
379
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1203
0.140 ms 1 /classes/Product.php:2902
413
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-bubblemorph-addon' LIMIT 1
0.140 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
421
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.140 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
638
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 102 LIMIT 1
0.140 ms 1 /classes/Category.php:1585
874
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 213 LIMIT 1
0.140 ms 1 /classes/Category.php:1585
18
SELECT SQL_NO_CACHE name, alias FROM `ps_hook_alias`
0.139 ms 88 /classes/Hook.php:342
361
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 353
0.139 ms 1 /classes/Product.php:2902
441
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-snow-addon' LIMIT 1
0.139 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
754
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 166 LIMIT 1
0.139 ms 1 /classes/Category.php:1585
798
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 182 LIMIT 1
0.139 ms 1 /classes/Category.php:1585
906
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 244 LIMIT 1
0.139 ms 1 /classes/Category.php:1585
981
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 514 LIMIT 1
0.139 ms 1 /classes/Category.php:1585
418
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.138 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
449
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-duotonefilters-addon' LIMIT 1
0.138 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
455
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-paintbrush-addon' LIMIT 1
0.138 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
625
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 336
0.138 ms 3 /classes/Product.php:3423
694
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 130 LIMIT 1
0.138 ms 1 /classes/Category.php:1585
33
SELECT SQL_NO_CACHE *
FROM `ps_currency` a
LEFT JOIN `ps_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.137 ms 1 /src/Adapter/EntityMapper.php:71
469
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.137 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
682
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 125 LIMIT 1
0.137 ms 1 /classes/Category.php:1585
726
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 146 LIMIT 1
0.137 ms 1 /classes/Category.php:1585
954
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 1201 LIMIT 1
0.136 ms 1 /classes/Category.php:1585
357
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 351
0.136 ms 1 /classes/Product.php:2902
403
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-particles-addon' LIMIT 1
0.136 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
412
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-refresh-addon' LIMIT 1
0.136 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
467
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.136 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
802
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 183 LIMIT 1
0.136 ms 1 /classes/Category.php:1585
814
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 186 LIMIT 1
0.136 ms 1 /classes/Category.php:1585
28
SELECT SQL_NO_CACHE c.id_currency
FROM `ps_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.135 ms 1 /classes/Currency.php:893
415
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-explodinglayers-addon' LIMIT 1
0.135 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
422
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.135 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
470
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.135 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
838
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 203 LIMIT 1
0.135 ms 1 /classes/Category.php:1585
52
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 10 LIMIT 1
0.135 ms 1 /classes/Category.php:1585
65
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.135 ms 1 /classes/Category.php:1585
429
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.135 ms 1 /classes/module/Module.php:2664
471
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.135 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
564
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 1205
0.135 ms 3 /classes/Product.php:3423
621
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 334
0.135 ms 3 /classes/Product.php:3423
623
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 335
0.135 ms 3 /classes/Product.php:3423
702
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 110 LIMIT 1
0.135 ms 1 /classes/Category.php:1585
830
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 210 LIMIT 1
0.135 ms 1 /classes/Category.php:1585
1043
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.135 ms 1 /classes/module/Module.php:2664
41
SELECT SQL_NO_CACHE *
FROM `ps_group` a
LEFT JOIN `ps_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.134 ms 1 /src/Adapter/EntityMapper.php:71
425
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 210 AND `id_shop` = 1 LIMIT 1
0.134 ms 1 /classes/module/Module.php:2137
742
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 163 LIMIT 1
0.134 ms 1 /classes/Category.php:1585
457
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.133 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
806
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 184 LIMIT 1
0.133 ms 1 /classes/Category.php:1585
822
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 180 LIMIT 1
0.133 ms 1 /classes/Category.php:1585
882
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 200 LIMIT 1
0.133 ms 1 /classes/Category.php:1585
409
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-panorama-addon' LIMIT 1
0.133 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
663
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.133 ms 1 /classes/Category.php:1591
942
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 282 LIMIT 1
0.133 ms 1 /classes/Category.php:1585
331
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 335 LIMIT 1
0.132 ms 10 /classes/SpecificPrice.php:435
674
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 122 LIMIT 1
0.132 ms 1 /classes/Category.php:1585
738
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 162 LIMIT 1
0.132 ms 1 /classes/Category.php:1585
958
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 1200 LIMIT 1
0.132 ms 1 /classes/Category.php:1585
1028
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 15 LIMIT 1
0.132 ms 1 /classes/Category.php:1585
1025
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 530 LIMIT 1
0.132 ms 1 /classes/Category.php:1585
207
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1200 AND id_shop=1 LIMIT 1
0.131 ms 1 /classes/Product.php:6887
359
SELECT SQL_NO_CACHE * FROM `ps_image_type`
0.131 ms 8 /classes/ImageType.php:161
454
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-explodinglayers-addon' LIMIT 1
0.131 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
456
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-domain-switch-addon' LIMIT 1
0.131 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
762
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 169 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
786
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 176 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
834
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 202 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
851
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.131 ms 1 /classes/Category.php:1591
402
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-snow-addon' LIMIT 1
0.131 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
722
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 145 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
783
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.131 ms 1 /classes/Category.php:1591
961
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 10 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
985
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 515 LIMIT 1
0.131 ms 1 /classes/Category.php:1585
269
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 1205 LIMIT 1
0.130 ms 1 /classes/SpecificPrice.php:435
36
SELECT SQL_NO_CACHE *
FROM `ps_country` a
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
221
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 282 LIMIT 1
0.130 ms 1 /classes/Category.php:1378
274
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 1205 LIMIT 1
0.130 ms 1 /classes/Pack.php:90
678
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 123 LIMIT 1
0.130 ms 1 /classes/Category.php:1585
719
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.130 ms 1 /classes/Category.php:1591
918
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 247 LIMIT 1
0.130 ms 1 /classes/Category.php:1585
1021
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 500 LIMIT 1
0.130 ms 1 /classes/Category.php:1585
698
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 131 LIMIT 1
0.129 ms 1 /classes/Category.php:1585
237
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 1202 LIMIT 1
0.129 ms 1 /classes/SpecificPrice.php:435
444
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-filmstrip-addon' LIMIT 1
0.129 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
461
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.129 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
531
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2181) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:453
533
SELECT SQL_NO_CACHE `id_category` FROM `ps_category_product`
WHERE `id_product` = 1202
0.129 ms 3 /classes/Product.php:3423
675
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.129 ms 1 /classes/Category.php:1591
710
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 100 LIMIT 1
0.129 ms 1 /classes/Category.php:1585
803
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.129 ms 1 /classes/Category.php:1591
926
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 250 LIMIT 1
0.129 ms 1 /classes/Category.php:1585
935
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.129 ms 1 /classes/Category.php:1591
973
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 512 LIMIT 1
0.129 ms 1 /classes/Category.php:1585
4
SELECT SQL_NO_CACHE *
FROM `ps_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
307
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 333 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6887
404
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-polyfold-addon' LIMIT 1
0.128 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
405
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-filmstrip-addon' LIMIT 1
0.128 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
423
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.128 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
427
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.128 ms 1 /classes/module/Module.php:2664
910
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 245 LIMIT 1
0.128 ms 1 /classes/Category.php:1585
965
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 501 LIMIT 1
0.128 ms 1 /classes/Category.php:1585
1001
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 523 LIMIT 1
0.128 ms 1 /classes/Category.php:1585
1009
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 525 LIMIT 1
0.128 ms 1 /classes/Category.php:1585
1054
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.128 ms 1 /classes/module/Module.php:2664
451
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-refresh-addon' LIMIT 1
0.128 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
950
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 1202 LIMIT 1
0.128 ms 1 /classes/Category.php:1585
846
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 211 LIMIT 1
0.127 ms 1 /classes/Category.php:1585
993
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 510 LIMIT 1
0.127 ms 1 /classes/Category.php:1585
22
SELECT SQL_NO_CACHE * FROM `ps_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.127 ms 1 /classes/module/Module.php:2046
174
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 358 LIMIT 1
0.127 ms 10 /classes/SpecificPrice.php:435
205
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 1200 LIMIT 1
0.127 ms 1 /classes/SpecificPrice.php:435
634
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 101 LIMIT 1
0.127 ms 1 /classes/Category.php:1585
34
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.126 ms 1 /classes/Language.php:883
353
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 336) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:453
448
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-panorama-addon' LIMIT 1
0.126 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
658
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 107 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
1032
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 1004 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
123
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 351 LIMIT 1
0.126 ms 1 /classes/Pack.php:90
419
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.126 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
447
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-weather-addon' LIMIT 1
0.126 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
468
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.126 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
758
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 167 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
790
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 160 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
826
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 201 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
930
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 252 LIMIT 1
0.126 ms 1 /classes/Category.php:1585
63
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.125 ms 0 /classes/module/Module.php:2664
453
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-liquideffect-addon' LIMIT 1
0.125 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
655
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.125 ms 1 /classes/Category.php:1591
690
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 124 LIMIT 1
0.125 ms 1 /classes/Category.php:1585
746
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 164 LIMIT 1
0.125 ms 1 /classes/Category.php:1585
329
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 201 LIMIT 1
0.124 ms 1 /classes/Product.php:5670
416
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-paintbrush-addon' LIMIT 1
0.124 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
458
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT 1
0.124 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
618
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitcountdown" LIMIT 1
0.124 ms 1 /classes/module/Module.php:2664
706
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 111 LIMIT 1
0.124 ms 1 /classes/Category.php:1585
875
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.124 ms 1 /classes/Category.php:1591
886
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 220 LIMIT 1
0.124 ms 1 /classes/Category.php:1585
989
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 516 LIMIT 1
0.124 ms 1 /classes/Category.php:1585
1005
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 524 LIMIT 1
0.124 ms 1 /classes/Category.php:1585
188
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE id_product = 360 LIMIT 1
0.123 ms 10 /classes/SpecificPrice.php:435
296
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 332) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.123 ms 1 /classes/stock/StockAvailable.php:453
410
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-duotonefilters-addon' LIMIT 1
0.123 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
411
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-revealer-addon' LIMIT 1
0.123 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
686
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 126 LIMIT 1
0.123 ms 1 /classes/Category.php:1585
714
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 142 LIMIT 1
0.123 ms 1 /classes/Category.php:1585
854
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 206 LIMIT 1
0.123 ms 1 /classes/Category.php:1585
858
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 207 LIMIT 1
0.123 ms 1 /classes/Category.php:1585
890
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 251 LIMIT 1
0.123 ms 1 /classes/Category.php:1585
516
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1641) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.123 ms 1 /classes/stock/StockAvailable.php:453
35
SELECT SQL_NO_CACHE `id_country`
FROM `ps_country`
WHERE `iso_code` = 'US' LIMIT 1
0.122 ms 1 /classes/Country.php:194
45
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.122 ms 1 /classes/Category.php:1585
83
SELECT SQL_NO_CACHE id_shop FROM ps_shop
0.122 ms 1 /classes/shop/Shop.php:751
643
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.122 ms 1 /classes/Category.php:1591
671
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.122 ms 1 /classes/Category.php:1591
1048
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 94 AND `id_shop` = 1 LIMIT 1
0.122 ms 1 /classes/module/Module.php:2137
1049
SELECT SQL_NO_CACHE data
FROM `ps_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.122 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
414
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-liquideffect-addon' LIMIT 1
0.122 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
460
SELECT SQL_NO_CACHE option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT 1
0.122 ms 25 /modules/revsliderprestashop/includes/revslider_db.class.php:192
934
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 240 LIMIT 1
0.122 ms 1 /classes/Category.php:1585
1038
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 2 LIMIT 1
0.122 ms 1 /classes/Category.php:1585
56
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 15 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
230
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1201) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:453
782
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 175 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
997
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 521 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
27
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.121 ms 1 /classes/Language.php:883
60
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 56 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
371
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 1200
0.121 ms 26 /classes/Product.php:2902
508
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1630) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:453
810
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 185 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
977
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 513 LIMIT 1
0.121 ms 1 /classes/Category.php:1585
289
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 332
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.120 ms 1 /classes/SpecificPrice.php:259
842
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 204 LIMIT 1
0.120 ms 1 /classes/Category.php:1585
124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.120 ms 1 /classes/stock/StockAvailable.php:453
241
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 1202 LIMIT 1
0.120 ms 1 /classes/Pack.php:89
293
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 332 AND `id_group` = 1 LIMIT 1
0.120 ms 0 /classes/GroupReduction.php:156
365
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `ps_product_attribute`
WHERE `id_product` = 357
0.120 ms 1 /classes/Product.php:2902
526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2176) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.120 ms 1 /classes/stock/StockAvailable.php:453
651
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.120 ms 1 /classes/Category.php:1591
301
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 201 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
699
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.119 ms 1 /classes/Category.php:1591
939
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.119 ms 1 /classes/Category.php:1591
85
SELECT SQL_NO_CACHE * FROM ps_hook_module
WHERE `id_hook` = 65
AND `id_module` = 196
AND `id_shop` = 1
0.118 ms 1 /classes/Hook.php:518
819
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.118 ms 1 /classes/Category.php:1591
867
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.118 ms 1 /classes/Category.php:1591
71
SELECT SQL_NO_CACHE *
FROM `ps_state` a
WHERE (a.`id_state` = 338) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
472
SELECT SQL_NO_CACHE `iso_code`
FROM `ps_country`
WHERE `id_country` = 6 LIMIT 1
0.117 ms 1 /classes/Country.php:275
532
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2182) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.117 ms 1 /classes/stock/StockAvailable.php:453
619
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 206 AND `id_shop` = 1 LIMIT 1
0.117 ms 1 /classes/module/Module.php:2137
794
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 181 LIMIT 1
0.117 ms 1 /classes/Category.php:1585
38
SELECT SQL_NO_CACHE *
FROM `ps_currency` a
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
627
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.117 ms 1 /classes/module/Module.php:2664
229
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 1201 LIMIT 1
0.116 ms 1 /classes/Pack.php:90
432
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 232 AND `id_shop` = 1 LIMIT 1
0.116 ms 1 /classes/module/Module.php:2137
503
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 282 LIMIT 1
0.116 ms 0 /classes/Category.php:1378
515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1640) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.116 ms 1 /classes/stock/StockAvailable.php:453
771
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.116 ms 1 /classes/Category.php:1591
871
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.116 ms 1 /classes/Category.php:1591
647
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.115 ms 1 /classes/Category.php:1591
430
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
0.115 ms 1 /classes/module/Module.php:2137
751
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.115 ms 1 /classes/Category.php:1591
895
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.115 ms 1 /classes/Category.php:1591
731
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.114 ms 1 /classes/Category.php:1591
73
SELECT SQL_NO_CACHE *
FROM `ps_country_lang`
WHERE `id_country` = 6
0.114 ms 3 /src/Adapter/EntityMapper.php:79
186
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 241 LIMIT 1
0.113 ms 1 /classes/Product.php:5670
258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1203 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6887
286
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 204 LIMIT 1
0.113 ms 1 /classes/Product.php:5670
433
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.113 ms 1 /classes/module/Module.php:2664
667
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.113 ms 1 /classes/Category.php:1591
775
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.113 ms 1 /classes/Category.php:1591
1022
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.113 ms 1 /classes/Category.php:1591
253
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 283 LIMIT 1
0.112 ms 1 /classes/Category.php:1378
521
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1648) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.112 ms 1 /classes/stock/StockAvailable.php:453
767
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.112 ms 1 /classes/Category.php:1591
847
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.112 ms 1 /classes/Category.php:1591
48
SELECT SQL_NO_CACHE `id_category`
FROM `ps_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.111 ms 1 /classes/Category.php:2450
76
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ets_extraoptions" LIMIT 1
0.111 ms 0 /classes/module/Module.php:2664
151
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 354 LIMIT 1
0.111 ms 1 /classes/Pack.php:90
156
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `ps_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 243 LIMIT 1
0.111 ms 1 /classes/Category.php:1378
1026
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.111 ms 1 /classes/Category.php:1591
37
SELECT SQL_NO_CACHE *
FROM `ps_country_lang`
WHERE `id_country` = 21
0.111 ms 3 /src/Adapter/EntityMapper.php:79
695
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.111 ms 1 /classes/Category.php:1591
947
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.110 ms 1 /classes/Category.php:1591
1044
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 211 AND `id_shop` = 1 LIMIT 1
0.110 ms 1 /classes/module/Module.php:2137
69
SELECT SQL_NO_CACHE format
FROM `ps_address_format`
WHERE `id_country` = 6 LIMIT 1
0.110 ms 1 /classes/AddressFormat.php:656
150
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 354 LIMIT 1
0.110 ms 1 /classes/Pack.php:89
507
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1628) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.110 ms 1 /classes/stock/StockAvailable.php:453
43
SELECT SQL_NO_CACHE id_shop
FROM `ps_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.109 ms 1 /classes/ObjectModel.php:1732
131
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 353
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.109 ms 1 /classes/SpecificPrice.php:259
196
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 360) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.109 ms 1 /classes/stock/StockAvailable.php:453
358
SELECT SQL_NO_CACHE state FROM ps_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.109 ms 1 /classes/FeatureFlag.php:105
779
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.109 ms 1 /classes/Category.php:1591
815
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.109 ms 1 /classes/Category.php:1591
899
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.109 ms 1 /classes/Category.php:1591
951
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.109 ms 1 /classes/Category.php:1591
74
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM ps_required_field
0.108 ms 2 /classes/ObjectModel.php:1595
138
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 353) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.108 ms 1 /classes/stock/StockAvailable.php:453
254
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 283 LIMIT 1
0.108 ms 1 /classes/Product.php:5670
631
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.108 ms 1 /classes/Category.php:1591
879
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.108 ms 1 /classes/Category.php:1591
911
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.108 ms 1 /classes/Category.php:1591
102
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 241 LIMIT 1
0.107 ms 1 /classes/Product.php:5670
110
SELECT SQL_NO_CACHE 1 FROM `ps_specific_price` WHERE `to` BETWEEN '2025-12-23 00:00:00' AND '2025-12-23 23:59:59' LIMIT 1
0.107 ms 1 /classes/SpecificPrice.php:381
261
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 1203 LIMIT 1
0.107 ms 1 /classes/Pack.php:90
350
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 336 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:156
743
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.107 ms 1 /classes/Category.php:1591
862
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `ps_category` c
LEFT JOIN `ps_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 208 LIMIT 1
0.107 ms 1 /classes/Category.php:1585
883
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.107 ms 1 /classes/Category.php:1591
923
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.107 ms 1 /classes/Category.php:1591
978
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.107 ms 1 /classes/Category.php:1591
1010
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.107 ms 1 /classes/Category.php:1591
164
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 357 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:156
234
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 282 LIMIT 1
0.106 ms 1 /classes/Product.php:5670
517
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1642) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:453
152
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:453
165
SELECT SQL_NO_CACHE COUNT(*) FROM `ps_pack` WHERE id_product_pack = 357 LIMIT 1
0.106 ms 1 /classes/Pack.php:89
239
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `ps_product_shop`
WHERE `id_product` = 1202 AND id_shop=1 LIMIT 1
0.106 ms 1 /classes/Product.php:6887
42
SELECT SQL_NO_CACHE *
FROM `ps_group_lang`
WHERE `id_group` = 1
0.105 ms 3 /src/Adapter/EntityMapper.php:79
210
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 1200 LIMIT 1
0.105 ms 1 /classes/Pack.php:90
739
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.105 ms 1 /classes/Category.php:1591
1014
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.105 ms 1 /classes/Category.php:1591
1045
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.105 ms 1 /classes/module/Module.php:2664
167
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.104 ms 1 /classes/stock/StockAvailable.php:453
823
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.104 ms 1 /classes/Category.php:1591
974
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.104 ms 1 /classes/Category.php:1591
30
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.103 ms 1 /classes/Language.php:883
53
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
160
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 357
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.103 ms 1 /classes/SpecificPrice.php:259
428
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 20 AND `id_shop` = 1 LIMIT 1
0.103 ms 1 /classes/module/Module.php:2137
523
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2173) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.103 ms 1 /classes/stock/StockAvailable.php:453
903
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
970
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
1002
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
1018
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
509
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1632) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.102 ms 1 /classes/stock/StockAvailable.php:453
529
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2179) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.102 ms 1 /classes/stock/StockAvailable.php:453
628
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 9 AND `id_shop` = 1 LIMIT 1
0.102 ms 1 /classes/module/Module.php:2137
831
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.102 ms 1 /classes/Category.php:1591
907
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.102 ms 1 /classes/Category.php:1591
919
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.102 ms 1 /classes/Category.php:1591
1006
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.102 ms 1 /classes/Category.php:1591
32
SELECT SQL_NO_CACHE c.id_currency
FROM `ps_currency` c
WHERE (iso_code = 'GBP') LIMIT 1
0.101 ms 1 /classes/Currency.php:893
111
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `ps_specific_price_priority`
WHERE `id_product` = 351
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 1 /classes/SpecificPrice.php:259
117
SELECT SQL_NO_CACHE *
FROM `ps_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.101 ms 1 /src/Adapter/EntityMapper.php:71
242
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 1202 LIMIT 1
0.101 ms 1 /classes/Pack.php:90
723
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
763
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
791
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
891
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
915
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
931
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
962
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
1047
SELECT SQL_NO_CACHE `id_module` FROM `ps_module` WHERE `name` = "iqitpopup" LIMIT 1
0.101 ms 1 /classes/module/Module.php:2664
142
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 241 LIMIT 1
0.101 ms 1 /classes/Product.php:5670
927
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
955
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
959
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.101 ms 1 /classes/Category.php:1591
1055
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 207 AND `id_shop` = 1 LIMIT 1
0.101 ms 1 /classes/module/Module.php:2137
39
SELECT SQL_NO_CACHE *
FROM `ps_currency_lang`
WHERE `id_currency` = 1
0.100 ms 1 /src/Adapter/EntityMapper.php:79
120
SELECT SQL_NO_CACHE `reduction`
FROM `ps_group`
WHERE `id_group` = 1 LIMIT 1
0.100 ms 1 /classes/Group.php:154
982
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
994
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
137
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 353 LIMIT 1
0.100 ms 1 /classes/Pack.php:90
807
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
839
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
863
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
943
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.100 ms 1 /classes/Category.php:1591
703
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
524
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2174) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.099 ms 1 /classes/stock/StockAvailable.php:453
735
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
827
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
835
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
1029
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
1033
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.099 ms 1 /classes/Category.php:1591
195
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 360 LIMIT 1
0.098 ms 1 /classes/Pack.php:90
755
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.098 ms 1 /classes/Category.php:1591
40
SELECT SQL_NO_CACHE id_shop
FROM `ps_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.097 ms 1 /classes/ObjectModel.php:1732
91
SELECT SQL_NO_CACHE *
FROM `ps_shop_url` a0
0.097 ms 1 /classes/PrestaShopCollection.php:383
208
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1200 AND `id_group` = 1 LIMIT 1
0.097 ms 0 /classes/GroupReduction.php:156
522
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2172) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.097 ms 1 /classes/stock/StockAvailable.php:453
639
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.097 ms 1 /classes/Category.php:1591
679
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.097 ms 1 /classes/Category.php:1591
518
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1645) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.097 ms 1 /classes/stock/StockAvailable.php:453
528
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2178) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.096 ms 1 /classes/stock/StockAvailable.php:453
530
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2180) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.096 ms 1 /classes/stock/StockAvailable.php:453
683
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.096 ms 1 /classes/Category.php:1591
799
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.096 ms 1 /classes/Category.php:1591
887
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.096 ms 1 /classes/Category.php:1591
525
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2175) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.096 ms 1 /classes/stock/StockAvailable.php:453
659
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.096 ms 1 /classes/Category.php:1591
966
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.096 ms 1 /classes/Category.php:1591
519
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1646) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.095 ms 1 /classes/stock/StockAvailable.php:453
520
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1647) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.095 ms 1 /classes/stock/StockAvailable.php:453
727
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.095 ms 1 /classes/Category.php:1591
434
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 172 AND `id_shop` = 1 LIMIT 1
0.095 ms 1 /classes/module/Module.php:2137
510
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1633) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.095 ms 1 /classes/stock/StockAvailable.php:453
1046
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 112 AND `id_shop` = 1 LIMIT 1
0.095 ms 1 /classes/module/Module.php:2137
46
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.094 ms 1 /classes/Category.php:1591
759
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.094 ms 1 /classes/Category.php:1591
527
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 2177) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.094 ms 1 /classes/stock/StockAvailable.php:453
49
SELECT SQL_NO_CACHE ctg.`id_group`
FROM ps_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.093 ms 1 /classes/Category.php:1754
512
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1636) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.093 ms 1 /classes/stock/StockAvailable.php:453
707
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
711
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
715
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
787
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
843
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
998
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
1036
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.093 ms 1 /classes/Category.php:1591
149
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 354 AND `id_group` = 1 LIMIT 1
0.092 ms 0 /classes/GroupReduction.php:156
272
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1205 AND `id_group` = 1 LIMIT 1
0.092 ms 0 /classes/GroupReduction.php:156
687
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.092 ms 1 /classes/Category.php:1591
691
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.092 ms 1 /classes/Category.php:1591
990
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.092 ms 1 /classes/Category.php:1591
514
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1638) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.092 ms 1 /classes/stock/StockAvailable.php:453
747
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.091 ms 1 /classes/Category.php:1591
811
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.091 ms 1 /classes/Category.php:1591
986
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.091 ms 1 /classes/Category.php:1591
77
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.090 ms 0 /classes/module/Module.php:2137
511
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1634) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.090 ms 1 /classes/stock/StockAvailable.php:453
240
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 1202 AND `id_group` = 1 LIMIT 1
0.089 ms 0 /classes/GroupReduction.php:156
31
SELECT SQL_NO_CACHE `id_lang` FROM `ps_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.089 ms 1 /classes/Language.php:883
172
SELECT SQL_NO_CACHE name FROM ps_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 240 LIMIT 1
0.089 ms 1 /classes/Product.php:5670
855
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.089 ms 1 /classes/Category.php:1591
513
SELECT SQL_NO_CACHE SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = 1202) AND (id_product_attribute = 1637) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.088 ms 1 /classes/stock/StockAvailable.php:453
64
SELECT SQL_NO_CACHE `id_module` FROM `ps_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.087 ms 0 /classes/module/Module.php:2137
70
SELECT SQL_NO_CACHE `need_identification_number`
FROM `ps_country`
WHERE `id_country` = 6 LIMIT 1
0.087 ms 1 /classes/Country.php:405
859
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.087 ms 1 /classes/Category.php:1591
166
SELECT SQL_NO_CACHE product_type FROM `ps_product` WHERE id_product = 357 LIMIT 1
0.086 ms 1 /classes/Pack.php:90
1039
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.085 ms 1 /classes/Category.php:1591
193
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 360 AND `id_group` = 1 LIMIT 1
0.084 ms 0 /classes/GroupReduction.php:156
66
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.083 ms 1 /classes/Category.php:1591
135
SELECT SQL_NO_CACHE `reduction`
FROM `ps_product_group_reduction_cache`
WHERE `id_product` = 353 AND `id_group` = 1 LIMIT 1
0.083 ms 0 /classes/GroupReduction.php:156
57
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.081 ms 1 /classes/Category.php:1591
795
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.081 ms 1 /classes/Category.php:1591
61
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `ps_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.080 ms 1 /classes/Category.php:1591

Doubles

109 queries
SELECT c.`nleft`, c.`nright`  FROM `ps_category` c
			LEFT JOIN `ps_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
109 queries
SELECT c.`nleft`, c.`nright` FROM `ps_category` c
            WHERE c.`id_category` = XX LIMIT XX
109 queries
SELECT c.*, cl.*  FROM `ps_category` c
			LEFT JOIN `ps_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
103 queries
SELECT *
FROM `ps_category` a
LEFT JOIN `ps_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `ps_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
91 queries
            SELECT a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
            pa.`reference`, pa.`eanXX`, pa.`isbn`, pa.`upc`, pa.`mpn`,
            pal.`available_now`, pal.`available_later`
            FROM `ps_attribute` a
            LEFT JOIN `ps_attribute_lang` al
                ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = XX)
            LEFT JOIN `ps_product_attribute_combination` pac
                ON (pac.`id_attribute` = a.`id_attribute`)
            LEFT JOIN `ps_product_attribute` pa
                ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
             INNER JOIN ps_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            LEFT JOIN `ps_product_attribute_lang` pal
                ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = XX)
            LEFT JOIN `ps_attribute_group_lang` agl
                ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
            WHERE pa.`id_product` = XX
                AND pac.`id_product_attribute` = XX
                AND agl.`id_lang` = XX
46 queries
SELECT SUM(quantity)
FROM `ps_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
19 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `ps_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `ps_cart_product` cp JOIN `ps_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `ps_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
17 queries
SELECT XX FROM `ps_specific_price` WHERE id_product = XX LIMIT XX
16 queries
SELECT image_shop.`id_image`
                    FROM `ps_image` i
                     INNER JOIN ps_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
16 queries
SELECT name FROM ps_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
16 queries
SELECT *
FROM `ps_product` a
LEFT JOIN `ps_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `ps_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
16 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `ps_product` p
INNER JOIN `ps_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `ps_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
16 queries
                            SELECT `id_tax_rules_group`
                            FROM `ps_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
16 queries
			SELECT `reduction`
			FROM `ps_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
16 queries
SELECT COUNT(*) FROM `ps_pack` WHERE id_product_pack = XX LIMIT XX
16 queries
SELECT product_type FROM `ps_product` WHERE id_product = XX LIMIT XX
16 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM ps_feature_product pf
                LEFT JOIN ps_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN ps_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN ps_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN ps_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
16 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `ps_image` i
             INNER JOIN ps_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `ps_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
16 queries
SELECT `id_product_attribute`
            FROM `ps_product_attribute`
            WHERE `id_product` = XX
16 queries
                SELECT `id_category` FROM `ps_category_product`
                WHERE `id_product` = XX
16 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `ps_product_attribute` pa
             INNER JOIN ps_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `ps_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `ps_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `ps_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `ps_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
15 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-global-settings' LIMIT XX
13 queries
SELECT `id_module` FROM `ps_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
11 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `ps_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
11 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `ps_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
9 queries
			SELECT cl.`link_rewrite`
			FROM `ps_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
6 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-static-css' LIMIT XX
4 queries
SELECT `id_lang` FROM `ps_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
3 queries
SELECT * FROM ps_hook_module
                  WHERE `id_hook` = XX
                  AND `id_module` = XX
                  AND `id_shop` = XX
3 queries
SELECT product_attribute_shop.`price`
			FROM `ps_product_attribute` pa
			 INNER JOIN ps_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
			WHERE pa.`id_product_attribute` = XX LIMIT XX
3 queries
SELECT pa.`available_date` FROM `ps_product` p LEFT JOIN `ps_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN ps_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) INNER JOIN ps_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) WHERE p.`id_product` = XX AND pa.`id_product` = XX AND pa.`id_product_attribute` = XX LIMIT XX
3 queries
SELECT *
FROM `ps_product_attribute` a
LEFT JOIN `ps_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = XX
WHERE (a.`id_product_attribute` = XX) LIMIT XX
3 queries
SELECT *
							FROM `ps_product_attribute_lang`
							WHERE `id_product_attribute` = XX
3 queries
SELECT al.`name` AS attribute_name
            FROM `ps_product_attribute_combination` pac
            LEFT JOIN `ps_attribute` a ON a.`id_attribute` = pac.`id_attribute`
            LEFT JOIN `ps_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
            LEFT JOIN `ps_attribute_lang` al ON (
                a.`id_attribute` = al.`id_attribute`
                AND al.`id_lang` = XX
            )
            WHERE pac.`id_product_attribute` = XX
            ORDER BY ag.`position` ASC, a.`position` ASC
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `ps_module` m
                LEFT JOIN `ps_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT *
FROM `ps_currency` a
LEFT JOIN `ps_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `ps_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
SELECT *
FROM `ps_country` a
LEFT JOIN `ps_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `ps_country_lang`
							WHERE `id_country` = XX
2 queries
		SELECT `id_category`
		FROM `ps_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `ps_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `ps_shop_url` aXX
2 queries
				SELECT `name`
				FROM `ps_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
				SELECT tr.*
				FROM `ps_tax_rule` tr
				JOIN `ps_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-addons' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-whiteboard-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-backup-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-typewriter-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-maintenance-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-snow-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-particles-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-polyfold-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-filmstrip-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-slicey-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-beforeafter-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-weather-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-panorama-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-duotonefilters-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-revealer-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-refresh-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-bubblemorph-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-liquideffect-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-explodinglayers-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-paintbrush-addon' LIMIT XX
2 queries
SELECT option_value FROM `ps_revslider_options` WHERE `option_name`='revslider-domain-switch-addon' LIMIT XX

Tables stress

440 category
354 category_lang
134 product_attribute
133 product_attribute_shop
112 product_attribute_combination
111 category_shop
111 attribute
111 attribute_lang
94 product_attribute_lang
92 attribute_group_lang
74 product
63 revslider_options
55 product_shop
48 stock_available
40 cart_product
35 image
35 pack
32 image_shop
32 specific_price
20 module
20 attribute_group
19 product_lang
19 category_product
19 image_lang
17 module_shop
16 product_group_reduction_cache
16 feature_product
16 feature_lang
16 feature_value_lang
16 feature
16 feature_shop
11 specific_price_priority
7 lang
7 currency
6 shop_url
6 country
6 hook
5 shop
5 hook_module
5 currency_shop
4 lang_shop
4 category_group
4 cart_rule
3 country_lang
3 country_shop
3 hook_alias
3 currency_lang
3 manufacturer
3 product_attribute_image
2 shop_group
2 configuration
2 group
2 group_shop
2 image_type
2 cart_rule_lang
2 tax_rule
2 tax_rules_group
2 simpleblog_category
2 simpleblog_category_lang
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 state
1 required_field
1 revslider_sliders
1 layered_category
1 manufacturer_shop
1 manufacturer_lang
1 product_sale
1 layered_filter_block
1 tax
1 tax_lang
1 feature_flag
1 iqit_elementor_category
1 orders
1 order_cart_rule
1 ganalytics_data

ObjectModel instances

Name Instances Source
Category 222 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 10]
/override/classes/Link.php:36 (__construct) [id: 10]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 15]
/override/classes/Link.php:36 (__construct) [id: 15]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 56]
/override/classes/Link.php:36 (__construct) [id: 56]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/classes/Meta.php:379 (__construct) [id: 2]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 101]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 102]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 103]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 104]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 105]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 106]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 107]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 108]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 109]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 121]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 122]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 123]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 125]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 126]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 124]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 130]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 131]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 110]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 111]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 100]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 142]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 144]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 145]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 146]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 140]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 161]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 162]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 163]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 164]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 165]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 166]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 167]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 169]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 170]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 171]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 172]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 173]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 175]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 176]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 160]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 181]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 182]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 183]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 184]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 185]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 186]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 187]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 180]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 201]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 210]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 202]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 203]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 204]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 211]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 205]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 206]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 207]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 208]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 209]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 212]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 213]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 214]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 200]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 220]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 251]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 241]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 242]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 243]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 244]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 245]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 246]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 247]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 248]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 250]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 252]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 240]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 281]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 282]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 280]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 1202]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 1201]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 1200]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 10]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 501]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 511]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 512]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 513]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 514]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 515]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 516]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 510]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 521]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 523]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 524]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 525]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 526]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 520]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 500]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 530]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 15]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 1004]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 56]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
/override/classes/Link.php:36 (__construct) [id: 2]
/override/classes/Link.php:53 (getParentsCategories) [id: 2]
Product 140 /classes/Link.php:113 (__construct) [id: 351]
/classes/Link.php:113 (__construct) [id: 353]
/classes/Link.php:113 (__construct) [id: 354]
/classes/Link.php:113 (__construct) [id: 357]
/classes/Link.php:113 (__construct) [id: 358]
/classes/Link.php:113 (__construct) [id: 360]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1201]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1203]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 332]
/classes/Link.php:113 (__construct) [id: 333]
/classes/Link.php:113 (__construct) [id: 334]
/classes/Link.php:113 (__construct) [id: 335]
/classes/Link.php:113 (__construct) [id: 336]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 351]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 353]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 354]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 357]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 358]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 360]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1200]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1201]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1202]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1203]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1205]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 332]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 333]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 334]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 335]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 336]
/classes/Link.php:113 (__construct) [id: 351]
/classes/Link.php:113 (__construct) [id: 353]
/classes/Link.php:113 (__construct) [id: 354]
/classes/Link.php:113 (__construct) [id: 357]
/classes/Link.php:113 (__construct) [id: 358]
/classes/Link.php:113 (__construct) [id: 360]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1201]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1203]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 332]
/classes/Link.php:113 (__construct) [id: 333]
/classes/Link.php:113 (__construct) [id: 334]
/classes/Link.php:113 (__construct) [id: 335]
/classes/Link.php:113 (__construct) [id: 336]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/classes/Link.php:113 (__construct) [id: 1200]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1202]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
/classes/Link.php:113 (__construct) [id: 1205]
Country 6 /config/config.inc.php:146 (__construct) [id: 6]
/classes/controller/FrontController.php:944 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
/modules/paypal/paypal.php:363 (__construct) [id: 6]
/modules/paypal/classes/AbstractMethodPaypal.php:86 (__construct) [id: 6]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Combination 3 /classes/Product.php:5923 (__construct) [id: 1378]
/classes/Product.php:5923 (__construct) [id: 1635]
/classes/Product.php:5923 (__construct) [id: 1737]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/classes/Tools.php:691 (getCurrencyInstance) [id: 1]
Group 3 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_payment_with_fee/ets_payment_with_fee.php:231 (__construct) [id: 1]
/modules/ets_payment_with_fee/ets_payment_with_fee.php:231 (__construct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 338]
/classes/controller/FrontController.php:1768 (__construct) [id: 338]
Language 2 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:561 (__construct) [id: 1]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
ShopUrl 2 /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Tax 1 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /override/classes/Link.php
218 /classes/Link.php
219 /classes/shop/ShopUrl.php
220 /override/classes/Dispatcher.php
221 /classes/Dispatcher.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
229 /src/Adapter/SymfonyContainer.php
230 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
231 /config/db_slave_server.inc.php
232 /src/Adapter/ContainerBuilder.php
233 /src/Adapter/Environment.php
234 /src/Core/EnvironmentInterface.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
236 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
237 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
238 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
245 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
246 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
247 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
249 /vendor/symfony/contracts/Service/ResetInterface.php
250 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
252 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
253 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
254 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
255 /vendor/symfony/contracts/Cache/ItemInterface.php
256 /vendor/psr/cache/src/CacheItemInterface.php
257 /vendor/psr/cache/src/CacheItemPoolInterface.php
258 /vendor/symfony/contracts/Cache/CacheInterface.php
259 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
261 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
262 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
263 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
264 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
265 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
267 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
268 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
319 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
321 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
323 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
324 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
325 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
326 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
327 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
328 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
329 /var/cache/prod/FrontContainer.php
330 /src/Adapter/Container/LegacyContainer.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
333 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
334 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
335 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
336 /vendor/psr/container/src/ContainerExceptionInterface.php
337 /vendor/psr/container/src/NotFoundExceptionInterface.php
338 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
339 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
340 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
341 /src/Adapter/Container/LegacyContainerInterface.php
342 /modules/contactform/vendor/autoload.php
343 /modules/contactform/vendor/composer/autoload_real.php
344 /modules/contactform/vendor/composer/autoload_static.php
345 /modules/dashactivity/vendor/autoload.php
346 /modules/dashactivity/vendor/composer/autoload_real.php
347 /modules/dashactivity/vendor/composer/autoload_static.php
348 /modules/dashtrends/vendor/autoload.php
349 /modules/dashtrends/vendor/composer/autoload_real.php
350 /modules/dashtrends/vendor/composer/platform_check.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/graphnvd3/vendor/autoload.php
356 /modules/graphnvd3/vendor/composer/autoload_real.php
357 /modules/graphnvd3/vendor/composer/autoload_static.php
358 /modules/gridhtml/vendor/autoload.php
359 /modules/gridhtml/vendor/composer/autoload_real.php
360 /modules/gridhtml/vendor/composer/autoload_static.php
361 /modules/ps_categorytree/vendor/autoload.php
362 /modules/ps_categorytree/vendor/composer/autoload_real.php
363 /modules/ps_categorytree/vendor/composer/platform_check.php
364 /modules/ps_categorytree/vendor/composer/autoload_static.php
365 /modules/ps_checkpayment/vendor/autoload.php
366 /modules/ps_checkpayment/vendor/composer/autoload_real.php
367 /modules/ps_checkpayment/vendor/composer/platform_check.php
368 /modules/ps_checkpayment/vendor/composer/autoload_static.php
369 /modules/ps_currencyselector/vendor/autoload.php
370 /modules/ps_currencyselector/vendor/composer/autoload_real.php
371 /modules/ps_currencyselector/vendor/composer/autoload_static.php
372 /modules/ps_customeraccountlinks/vendor/autoload.php
373 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
374 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
375 /modules/ps_customersignin/vendor/autoload.php
376 /modules/ps_customersignin/vendor/composer/autoload_real.php
377 /modules/ps_customersignin/vendor/composer/autoload_static.php
378 /modules/ps_facetedsearch/vendor/autoload.php
379 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
380 /modules/ps_facetedsearch/vendor/composer/platform_check.php
381 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
382 /modules/ps_languageselector/vendor/autoload.php
383 /modules/ps_languageselector/vendor/composer/autoload_real.php
384 /modules/ps_languageselector/vendor/composer/autoload_static.php
385 /modules/ps_sharebuttons/vendor/autoload.php
386 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
387 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
388 /modules/ps_shoppingcart/vendor/autoload.php
389 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
390 /modules/ps_shoppingcart/vendor/composer/platform_check.php
391 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
392 /modules/ps_themecusto/vendor/autoload.php
393 /modules/ps_themecusto/vendor/composer/autoload_real.php
394 /modules/ps_themecusto/vendor/composer/autoload_static.php
395 /modules/ps_wirepayment/vendor/autoload.php
396 /modules/ps_wirepayment/vendor/composer/autoload_real.php
397 /modules/ps_wirepayment/vendor/composer/platform_check.php
398 /modules/ps_wirepayment/vendor/composer/autoload_static.php
399 /modules/pagesnotfound/vendor/autoload.php
400 /modules/pagesnotfound/vendor/composer/autoload_real.php
401 /modules/pagesnotfound/vendor/composer/platform_check.php
402 /modules/pagesnotfound/vendor/composer/autoload_static.php
403 /modules/statsbestcategories/vendor/autoload.php
404 /modules/statsbestcategories/vendor/composer/autoload_real.php
405 /modules/statsbestcategories/vendor/composer/platform_check.php
406 /modules/statsbestcategories/vendor/composer/autoload_static.php
407 /modules/statsbestcustomers/vendor/autoload.php
408 /modules/statsbestcustomers/vendor/composer/autoload_real.php
409 /modules/statsbestcustomers/vendor/composer/platform_check.php
410 /modules/statsbestcustomers/vendor/composer/autoload_static.php
411 /modules/statsbestproducts/vendor/autoload.php
412 /modules/statsbestproducts/vendor/composer/autoload_real.php
413 /modules/statsbestproducts/vendor/composer/platform_check.php
414 /modules/statsbestproducts/vendor/composer/autoload_static.php
415 /modules/statsbestsuppliers/vendor/autoload.php
416 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
417 /modules/statsbestsuppliers/vendor/composer/platform_check.php
418 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
419 /modules/statsbestvouchers/vendor/autoload.php
420 /modules/statsbestvouchers/vendor/composer/autoload_real.php
421 /modules/statsbestvouchers/vendor/composer/platform_check.php
422 /modules/statsbestvouchers/vendor/composer/autoload_static.php
423 /modules/statscarrier/vendor/autoload.php
424 /modules/statscarrier/vendor/composer/autoload_real.php
425 /modules/statscarrier/vendor/composer/platform_check.php
426 /modules/statscarrier/vendor/composer/autoload_static.php
427 /modules/statscatalog/vendor/autoload.php
428 /modules/statscatalog/vendor/composer/autoload_real.php
429 /modules/statscatalog/vendor/composer/platform_check.php
430 /modules/statscatalog/vendor/composer/autoload_static.php
431 /modules/statscheckup/vendor/autoload.php
432 /modules/statscheckup/vendor/composer/autoload_real.php
433 /modules/statscheckup/vendor/composer/platform_check.php
434 /modules/statscheckup/vendor/composer/autoload_static.php
435 /modules/statsdata/vendor/autoload.php
436 /modules/statsdata/vendor/composer/autoload_real.php
437 /modules/statsdata/vendor/composer/platform_check.php
438 /modules/statsdata/vendor/composer/autoload_static.php
439 /modules/statsforecast/vendor/autoload.php
440 /modules/statsforecast/vendor/composer/autoload_real.php
441 /modules/statsforecast/vendor/composer/platform_check.php
442 /modules/statsforecast/vendor/composer/autoload_static.php
443 /modules/statslive/vendor/autoload.php
444 /modules/statslive/vendor/composer/autoload_real.php
445 /modules/statslive/vendor/composer/autoload_static.php
446 /modules/statsnewsletter/vendor/autoload.php
447 /modules/statsnewsletter/vendor/composer/autoload_real.php
448 /modules/statsnewsletter/vendor/composer/platform_check.php
449 /modules/statsnewsletter/vendor/composer/autoload_static.php
450 /modules/statspersonalinfos/vendor/autoload.php
451 /modules/statspersonalinfos/vendor/composer/autoload_real.php
452 /modules/statspersonalinfos/vendor/composer/platform_check.php
453 /modules/statspersonalinfos/vendor/composer/autoload_static.php
454 /modules/statsproduct/vendor/autoload.php
455 /modules/statsproduct/vendor/composer/autoload_real.php
456 /modules/statsproduct/vendor/composer/platform_check.php
457 /modules/statsproduct/vendor/composer/autoload_static.php
458 /modules/statsregistrations/vendor/autoload.php
459 /modules/statsregistrations/vendor/composer/autoload_real.php
460 /modules/statsregistrations/vendor/composer/platform_check.php
461 /modules/statsregistrations/vendor/composer/autoload_static.php
462 /modules/statssales/vendor/autoload.php
463 /modules/statssales/vendor/composer/autoload_real.php
464 /modules/statssales/vendor/composer/platform_check.php
465 /modules/statssales/vendor/composer/autoload_static.php
466 /modules/statssearch/vendor/autoload.php
467 /modules/statssearch/vendor/composer/autoload_real.php
468 /modules/statssearch/vendor/composer/platform_check.php
469 /modules/statssearch/vendor/composer/autoload_static.php
470 /modules/statsstock/vendor/autoload.php
471 /modules/statsstock/vendor/composer/autoload_real.php
472 /modules/statsstock/vendor/composer/platform_check.php
473 /modules/statsstock/vendor/composer/autoload_static.php
474 /modules/statsvisits/vendor/autoload.php
475 /modules/statsvisits/vendor/composer/autoload_real.php
476 /modules/statsvisits/vendor/composer/autoload_static.php
477 /modules/gamification/vendor/autoload.php
478 /modules/gamification/vendor/composer/autoload_real.php
479 /modules/gamification/vendor/composer/autoload_static.php
480 /modules/cronjobs/vendor/autoload.php
481 /modules/cronjobs/vendor/composer/autoload_real.php
482 /modules/cronjobs/vendor/composer/autoload_static.php
483 /modules/autoupgrade/vendor/autoload.php
484 /modules/autoupgrade/vendor/composer/autoload_real.php
485 /modules/autoupgrade/vendor/composer/autoload_static.php
486 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
487 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
488 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
489 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
490 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
491 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
492 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
493 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
494 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
495 /modules/dashproducts/vendor/autoload.php
496 /modules/dashproducts/vendor/composer/autoload_real.php
497 /modules/dashproducts/vendor/composer/platform_check.php
498 /modules/dashproducts/vendor/composer/autoload_static.php
499 /modules/psaddonsconnect/vendor/autoload.php
500 /modules/psaddonsconnect/vendor/composer/autoload_real.php
501 /modules/psaddonsconnect/vendor/composer/autoload_static.php
502 /modules/psaddonsconnect/vendor/react/promise/src/functions_include.php
503 /modules/psaddonsconnect/vendor/react/promise/src/functions.php
504 /modules/psgdpr/vendor/autoload.php
505 /modules/psgdpr/vendor/composer/autoload_real.php
506 /modules/psgdpr/vendor/composer/autoload_static.php
507 /modules/ps_crossselling/vendor/autoload.php
508 /modules/ps_crossselling/vendor/composer/autoload_real.php
509 /modules/ps_crossselling/vendor/composer/platform_check.php
510 /modules/ps_crossselling/vendor/composer/autoload_static.php
511 /modules/ps_viewedproduct/vendor/autoload.php
512 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
513 /modules/ps_viewedproduct/vendor/composer/platform_check.php
514 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
515 /modules/gsitemap/vendor/autoload.php
516 /modules/gsitemap/vendor/composer/autoload_real.php
517 /modules/gsitemap/vendor/composer/platform_check.php
518 /modules/gsitemap/vendor/composer/autoload_static.php
519 /modules/ps_faviconnotificationbo/vendor/autoload.php
520 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
521 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
522 /modules/packlink/vendor/autoload.php
523 /modules/packlink/vendor/composer/autoload_real.php
524 /modules/packlink/vendor/composer/platform_check.php
525 /modules/packlink/vendor/composer/autoload_static.php
526 /modules/ps_emailsubscription/vendor/autoload.php
527 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
528 /modules/ps_emailsubscription/vendor/composer/platform_check.php
529 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
530 /modules/ps_eventbus/vendor/autoload.php
531 /modules/ps_eventbus/vendor/composer/autoload_real.php
532 /modules/ps_eventbus/vendor/composer/autoload_static.php
533 /modules/pscartbanner/vendor/autoload.php
534 /modules/pscartbanner/vendor/composer/autoload_real.php
535 /modules/pscartbanner/vendor/composer/autoload_static.php
536 /modules/paypal/vendor/autoload.php
537 /modules/paypal/vendor/composer/autoload_real.php
538 /modules/paypal/vendor/composer/autoload_static.php
539 /modules/ps_distributionapiclient/vendor/autoload.php
540 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
541 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
542 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
543 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
544 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
545 /modules/ps_dataprivacy/vendor/autoload.php
546 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
547 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
548 /modules/iqitproductflags/vendor/autoload.php
549 /modules/iqitproductflags/vendor/composer/autoload_real.php
550 /modules/iqitproductflags/vendor/composer/platform_check.php
551 /modules/iqitproductflags/vendor/composer/autoload_static.php
552 /modules/iqitproductvariants/vendor/autoload.php
553 /modules/iqitproductvariants/vendor/composer/autoload_real.php
554 /modules/iqitproductvariants/vendor/composer/autoload_static.php
555 /modules/sendinblue/vendor/autoload.php
556 /modules/sendinblue/vendor/composer/autoload_real.php
557 /modules/sendinblue/vendor/composer/platform_check.php
558 /modules/sendinblue/vendor/composer/autoload_static.php
559 /modules/ps_emailalerts/vendor/autoload.php
560 /modules/ps_emailalerts/vendor/composer/autoload_real.php
561 /modules/ps_emailalerts/vendor/composer/autoload_static.php
562 /modules/iqitsociallogin/vendor/autoload.php
563 /modules/iqitsociallogin/vendor/composer/autoload_real.php
564 /modules/iqitsociallogin/vendor/composer/platform_check.php
565 /modules/iqitsociallogin/vendor/composer/autoload_static.php
566 /modules/ps_googleanalytics/vendor/autoload.php
567 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
568 /modules/ps_googleanalytics/vendor/composer/platform_check.php
569 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
570 /modules/ph_simpleblog/vendor/autoload.php
571 /modules/ph_simpleblog/vendor/composer/autoload_real.php
572 /modules/ph_simpleblog/vendor/composer/platform_check.php
573 /modules/ph_simpleblog/vendor/composer/autoload_static.php
574 /modules/ps_mbo/vendor/autoload.php
575 /modules/ps_mbo/vendor/composer/autoload_real.php
576 /modules/ps_mbo/vendor/composer/platform_check.php
577 /modules/ps_mbo/vendor/composer/autoload_static.php
578 /modules/ps_mbo/vendor/clue/stream-filter/src/functions_include.php
579 /modules/ps_mbo/vendor/clue/stream-filter/src/functions.php
580 /modules/ps_mbo/vendor/php-http/message/src/filters.php
581 /modules/ps_mbo/vendor/sentry/sentry/src/functions.php
582 /modules/ps_mbo/bootstrap.php
583 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
584 /modules/ps_accounts/vendor/autoload.php
585 /modules/ps_accounts/vendor/composer/autoload_real.php
586 /modules/ps_accounts/vendor/composer/platform_check.php
587 /modules/ps_accounts/vendor/composer/autoload_static.php
588 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
589 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
590 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
591 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
592 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
593 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
594 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
595 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
596 /src/Core/Hook/HookModuleFilter.php
597 /src/Core/Hook/HookModuleFilterInterface.php
598 /modules/ph_simpleblog/ph_simpleblog.php
599 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
600 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
601 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
602 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
603 /modules/ph_simpleblog/models/SimpleBlogCategory.php
604 /modules/ph_simpleblog/models/SimpleBlogPost.php
605 /modules/ph_simpleblog/models/SimpleBlogPostType.php
606 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
607 /modules/ph_simpleblog/models/SimpleBlogTag.php
608 /modules/ph_simpleblog/models/SimpleBlogComment.php
609 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
610 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
611 /modules/ph_simpleblog/classes/BlogPostsFinder.php
612 /modules/ph_simpleblog/controllers/front/default_list.php
613 /classes/controller/ModuleFrontController.php
614 /override/classes/controller/FrontController.php
615 /classes/controller/FrontController.php
616 /src/Core/Security/Hashing.php
617 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
618 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
619 /classes/Translate.php
620 /modules/ph_simpleblog/translations/es.php
621 /override/controllers/front/listing/CategoryController.php
622 /controllers/front/listing/CategoryController.php
623 /classes/controller/ProductListingFrontController.php
624 /classes/controller/ProductPresentingFrontController.php
625 /src/PrestaShopBundle/Translation/TranslatorComponent.php
626 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
627 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
628 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
629 /vendor/symfony/contracts/Translation/TranslatorInterface.php
630 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
631 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
632 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
633 /src/PrestaShopBundle/Translation/TranslatorInterface.php
634 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
635 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
636 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
637 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
638 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
639 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
640 /vendor/symfony/contracts/Translation/TranslatorTrait.php
641 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
642 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
643 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
644 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
645 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
646 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
647 /src/Adapter/Presenter/Object/ObjectPresenter.php
648 /src/Adapter/Presenter/PresenterInterface.php
649 /src/Adapter/Presenter/Cart/CartPresenter.php
650 /src/Adapter/Image/ImageRetriever.php
651 /classes/tax/TaxConfiguration.php
652 /classes/Smarty/TemplateFinder.php
653 /classes/assets/StylesheetManager.php
654 /classes/assets/AbstractAssetManager.php
655 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
656 /classes/assets/JavascriptManager.php
657 /classes/assets/CccReducer.php
658 /modules/iqitthemeeditor/iqitthemeeditor.php
659 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
660 /modules/iqitthemeeditor/translations/es.php
661 /classes/Category.php
662 /classes/webservice/WebserviceRequest.php
663 /src/Core/Localization/Locale/Repository.php
664 /src/Core/Localization/Locale/RepositoryInterface.php
665 /src/Core/Localization/CLDR/LocaleRepository.php
666 /src/Core/Localization/CLDR/LocaleDataSource.php
667 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
668 /src/Core/Data/Layer/AbstractDataLayer.php
669 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
670 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
671 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
672 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
673 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
674 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
675 /vendor/symfony/contracts/Cache/CacheTrait.php
676 /vendor/psr/cache/src/InvalidArgumentException.php
677 /vendor/psr/cache/src/CacheException.php
678 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
679 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
680 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
681 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
682 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
683 /src/Core/Localization/CLDR/Reader.php
684 /src/Core/Localization/CLDR/ReaderInterface.php
685 /src/Core/Localization/Currency/Repository.php
686 /src/Core/Localization/Currency/RepositoryInterface.php
687 /src/Core/Localization/Currency/CurrencyDataSource.php
688 /src/Core/Localization/Currency/DataSourceInterface.php
689 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
690 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
691 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
692 /src/Adapter/Currency/CurrencyDataProvider.php
693 /src/Core/Currency/CurrencyDataProviderInterface.php
694 /src/Adapter/LegacyContext.php
695 /src/Adapter/Tools.php
696 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
697 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
698 /vendor/prestashop/decimal/src/Operation/Rounding.php
699 /src/Core/Localization/Locale.php
700 /src/Core/Localization/LocaleInterface.php
701 /src/Core/Localization/Specification/Price.php
702 /src/Core/Localization/Specification/Number.php
703 /src/Core/Localization/Specification/NumberInterface.php
704 /src/Core/Localization/Specification/Factory.php
705 /src/Core/Localization/CLDR/LocaleData.php
706 /src/Core/Localization/CLDR/NumberSymbolsData.php
707 /src/Core/Localization/CLDR/CurrencyData.php
708 /src/Core/Localization/CLDR/Locale.php
709 /src/Core/Localization/CLDR/LocaleInterface.php
710 /src/Core/Localization/Specification/NumberSymbolList.php
711 /classes/Currency.php
712 /src/Core/Localization/Currency/LocalizedCurrencyId.php
713 /src/Core/Localization/Currency/CurrencyData.php
714 /src/Core/Localization/Currency/CurrencyCollection.php
715 /src/Core/Localization/Currency.php
716 /src/Core/Localization/CurrencyInterface.php
717 /src/Core/Localization/Specification/NumberCollection.php
718 /src/Core/Localization/Number/Formatter.php
719 /override/classes/Cart.php
720 /classes/Cart.php
721 /src/Adapter/AddressFactory.php
722 /classes/CartRule.php
723 /src/Core/Util/String/StringModifier.php
724 /src/Core/Util/String/StringModifierInterface.php
725 /classes/Product.php
726 /src/Core/Domain/Product/ValueObject/RedirectType.php
727 /src/Core/Util/DateTime/DateTime.php
728 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
729 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
730 /src/Core/Domain/Product/ValueObject/ProductType.php
731 /src/Core/Domain/Product/ValueObject/Reference.php
732 /src/Core/Domain/Product/ValueObject/Ean13.php
733 /src/Core/Domain/Product/ValueObject/Isbn.php
734 /src/Core/Domain/Product/ValueObject/Upc.php
735 /src/Core/Domain/Product/ProductSettings.php
736 /src/Core/Domain/Shop/ValueObject/ShopId.php
737 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
738 /modules/ps_emailsubscription/ps_emailsubscription.php
739 /src/Core/Module/WidgetInterface.php
740 /src/PrestaShopBundle/Translation/DomainNormalizer.php
741 /classes/Media.php
742 /modules/iqitproductvariants/iqitproductvariants.php
743 /src/Adapter/Localization/LegacyTranslator.php
744 /modules/iqitproductvariants/translations/es.php
745 /modules/ps_emailalerts/ps_emailalerts.php
746 /modules/ps_emailalerts/MailAlert.php
747 /src/Adapter/Presenter/Cart/CartLazyArray.php
748 /src/Adapter/Presenter/AbstractLazyArray.php
749 /src/Adapter/Product/PriceFormatter.php
750 /src/Core/Util/Inflector.php
751 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
752 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
753 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
754 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
755 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
756 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
757 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
758 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
759 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
760 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
761 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
762 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
763 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
764 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
765 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
766 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
767 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
768 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
769 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
770 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
771 /classes/Gender.php
772 /classes/Risk.php
773 /classes/Meta.php
774 /classes/Address.php
775 /classes/ImageType.php
776 /classes/State.php
777 /src/Core/Security/PasswordPolicyConfiguration.php
778 /src/Core/Configuration/DataConfigurationInterface.php
779 /src/Core/Filter/FrontEndObject/MainFilter.php
780 /src/Core/Filter/FilterInterface.php
781 /src/Core/Filter/FrontEndObject/CartFilter.php
782 /src/Core/Filter/HashMapWhitelistFilter.php
783 /src/Core/Filter/CollectionFilter.php
784 /src/Core/Filter/FrontEndObject/ProductFilter.php
785 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
786 /src/Core/Filter/FrontEndObject/CustomerFilter.php
787 /src/Core/Filter/FrontEndObject/ShopFilter.php
788 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
789 /modules/ets_payment_with_fee/ets_payment_with_fee.php
790 /modules/ets_payment_with_fee/classes/ets_paymentmethod_class.php
791 /modules/ets_payment_with_fee/classes/ets_payment_cart_class.php
792 /modules/ets_payment_with_fee/classes/ets_payment_utils.php
793 /classes/PaymentModule.php
794 /modules/ets_payment_with_fee/translations/es.php
795 /classes/ProductDownload.php
796 /classes/tax/Tax.php
797 /src/Core/Localization/CLDR/ComputingPrecision.php
798 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
799 /src/Core/Cart/Calculator.php
800 /src/Core/Cart/CartRowCollection.php
801 /src/Core/Cart/Fees.php
802 /src/Core/Cart/AmountImmutable.php
803 /src/Core/Cart/CartRuleCollection.php
804 /src/Core/Cart/CartRuleCalculator.php
805 /src/Adapter/Product/PriceCalculator.php
806 /override/classes/order/Order.php
807 /classes/order/Order.php
808 /src/Core/Cart/CartRow.php
809 /modules/revsliderprestashop/revsliderprestashop.php
810 /modules/revsliderprestashop/rev-loader.php
811 /modules/revsliderprestashop/includes/revslider_db.class.php
812 /modules/revsliderprestashop/includes/data.class.php
813 /modules/revsliderprestashop/includes/functions.class.php
814 /modules/revsliderprestashop/includes/em-integration.class.php
815 /modules/revsliderprestashop/includes/cssparser.class.php
816 /modules/revsliderprestashop/includes/woocommerce.class.php
817 /modules/revsliderprestashop/includes/wpml.class.php
818 /modules/revsliderprestashop/includes/colorpicker.class.php
819 /modules/revsliderprestashop/includes/navigation.class.php
820 /modules/revsliderprestashop/includes/object-library.class.php
821 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
822 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
823 /modules/revsliderprestashop/includes/extension.class.php
824 /modules/revsliderprestashop/includes/favorite.class.php
825 /modules/revsliderprestashop/includes/aq-resizer.class.php
826 /modules/revsliderprestashop/includes/external-sources.class.php
827 /modules/revsliderprestashop/includes/page-template.class.php
828 /modules/revsliderprestashop/includes/slider.class.php
829 /modules/revsliderprestashop/includes/slide.class.php
830 /modules/revsliderprestashop/includes/output.class.php
831 /modules/revsliderprestashop/public/revslider-front.class.php
832 /modules/revsliderprestashop/includes/backwards.php
833 /modules/revsliderprestashop/admin/includes/class-pclzip.php
834 /modules/revsliderprestashop/admin/includes/license.class.php
835 /modules/revsliderprestashop/admin/includes/addons.class.php
836 /modules/revsliderprestashop/admin/includes/template.class.php
837 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
838 /modules/revsliderprestashop/admin/includes/folder.class.php
839 /modules/revsliderprestashop/admin/includes/import.class.php
840 /modules/revsliderprestashop/admin/includes/export.class.php
841 /modules/revsliderprestashop/admin/includes/export-html.class.php
842 /modules/revsliderprestashop/admin/includes/newsletter.class.php
843 /modules/revsliderprestashop/admin/revslider-admin.class.php
844 /modules/revsliderprestashop/includes/update.class.php
845 /modules/revsliderprestashop/includes/resize-imag.php
846 /modules/revsliderprestashop/translations/es.php
847 /modules/ps_shoppingcart/ps_shoppingcart.php
848 /modules/acactiv/acactiv.php
849 /modules/acactiv/translations/es.php
850 /modules/acactiv/key.php
851 /modules/paypal/paypal.php
852 /modules/paypal/config_prod.php
853 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
854 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
855 /modules/paypal/translations/es.php
856 /modules/paypal/services/ToolKit.php
857 /modules/paypal/classes/Constants/PaypalConfigurations.php
858 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
859 /modules/paypal/classes/Constants/WebHookConf.php
860 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
861 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
862 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
863 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
864 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
865 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
866 /modules/paypal/diagnostic.php
867 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
868 /modules/paypal/classes/AbstractMethodPaypal.php
869 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
870 /modules/paypal/classes/MethodEC.php
871 /modules/paypal/classes/WhiteList/WhiteListService.php
872 /modules/paypal/classes/API/PaypalApiManager.php
873 /modules/paypal/classes/API/PaypalApiManagerInterface.php
874 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
875 /modules/paypal/classes/API/PaypalWebhookApiManagerInterface.php
876 /modules/paypal/classes/API/PaypalClient.php
877 /modules/paypal/classes/API/Client/HttpClient.php
878 /modules/paypal/classes/API/ClientInterface.php
879 /modules/paypal/classes/API/Environment/PaypalEnvironment.php
880 /modules/paypal/classes/API/EnvironmentInterface.php
881 /modules/paypal/classes/API/Injector/AuthorizationInjector.php
882 /modules/paypal/classes/API/InjectorInterface.php
883 /modules/paypal/classes/API/Injector/BnCodeInjector.php
884 /modules/paypal/classes/API/Injector/UserAgentInjector.php
885 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
886 /var/cache/prod/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
887 /modules/iqitpopup/iqitpopup.php
888 /modules/iqitpopup/translations/es.php
889 /modules/iqitsizecharts/iqitsizecharts.php
890 /modules/iqitsizecharts/src/IqitSizeCharts.php
891 /modules/iqitsizecharts/translations/es.php
892 /modules/iqitreviews/iqitreviews.php
893 /modules/iqitreviews/src/IqitProductReview.php
894 /modules/iqitextendedproduct/iqitextendedproduct.php
895 /modules/iqitextendedproduct/src/IqitThreeSixty.php
896 /modules/iqitextendedproduct/src/IqitProductVideo.php
897 /modules/iqitextendedproduct/translations/es.php
898 /modules/iqitelementor/iqitelementor.php
899 /modules/iqitelementor/src/IqitElementorLanding.php
900 /modules/iqitelementor/src/IqitElementorTemplate.php
901 /modules/iqitelementor/src/IqitElementorProduct.php
902 /modules/iqitelementor/src/IqitElementorCategory.php
903 /modules/iqitelementor/src/IqitElementorContent.php
904 /modules/iqitelementor/src/iqitElementorWpHelper.php
905 /modules/iqitelementor/includes/plugin-elementor.php
906 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
907 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
908 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
909 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
910 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
911 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
912 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
913 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
914 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
915 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
916 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
917 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
918 /modules/iqitelementor/translations/es.php
919 /modules/iqitmegamenu/iqitmegamenu.php
920 /modules/iqitmegamenu/models/IqitMenuTab.php
921 /modules/iqitmegamenu/models/IqitMenuHtml.php
922 /modules/iqitmegamenu/models/IqitMenuLinks.php
923 /modules/iqitmegamenu/translations/es.php
924 /modules/ets_recaptcha_free/ets_recaptcha_free.php
925 /modules/ets_recaptcha_free/classes/ets_rcf_defines.php
926 /modules/ets_recaptcha_free/translations/es.php
927 /modules/feedelmercaderio/feedelmercaderio.php
928 /modules/feedelmercaderio/models/FemCategoryEquivalence.php
929 /modules/feedelmercaderio/models/FemAttributeGroupEquivalence.php
930 /modules/feedelmercaderio/models/FemAttributeEquivalence.php
931 /modules/feedelmercaderio/translations/es.php
932 /modules/seigicookie/seigicookie.php
933 /modules/seigicookie/seigicookie.inc.php
934 /modules/seigicookie/util/license.php
935 /modules/seigicookie/util/instance.php
936 /modules/seigicookie/util/translator/translator.php
937 /modules/seigicookie/classes/Upgrade.php
938 /modules/seigicookie/util/module/Upgrade.php
939 /modules/seigicookie/util/tools/MessagesTrait.php
940 /modules/seigicookie/util/AssetLoader.php
941 /modules/seigicookie/util/Link.php
942 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
943 /modules/cronjobs/cronjobs.php
944 /modules/cronjobs/classes/CronJobsForms.php
945 /modules/cronjobs/translations/es.php
946 /modules/ps_mbo/ps_mbo.php
947 /modules/ps_mbo/src/Traits/HaveTabs.php
948 /modules/ps_mbo/src/Traits/UseHooks.php
949 /modules/ps_mbo/src/Traits/Hooks/UseDisplayBackOfficeEmployeeMenu.php
950 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneOne.php
951 /modules/ps_mbo/src/Traits/HaveCdcComponent.php
952 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneTwo.php
953 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneThree.php
954 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminThemesListAfter.php
955 /modules/ps_mbo/src/Traits/Hooks/UseDisplayDashboardTop.php
956 /modules/ps_mbo/src/Traits/Hooks/UseActionAdminControllerSetMedia.php
957 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeInstallModule.php
958 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAdminToolbarButtons.php
959 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAlternativeSearchPanels.php
960 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminAfterHeader.php
961 /modules/ps_mbo/src/Traits/Hooks/UseDisplayModuleConfigureExtraButtons.php
962 /modules/ps_mbo/src/Traits/Hooks/UseActionListModules.php
963 /modules/ps_mbo/src/Traits/Hooks/UseActionModuleRegisterHookAfter.php
964 /modules/ps_mbo/src/Traits/Hooks/UseDisplayEmptyModuleCategoryExtraMessage.php
965 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectShopUrlUpdateAfter.php
966 /modules/ps_mbo/src/Traits/Hooks/UseActionGeneralPageSave.php
967 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeUpgradeModule.php
968 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeDeleteBefore.php
969 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeUpdateBefore.php
970 /modules/ps_mbo/src/Traits/HaveShopOnExternalService.php
971 /modules/ps_mbo/src/Tab/TabInterface.php
972 /modules/ps_distributionapiclient/vendor/symfony/string/UnicodeString.php
973 /modules/ps_distributionapiclient/vendor/symfony/string/AbstractUnicodeString.php
974 /modules/ps_distributionapiclient/vendor/symfony/string/AbstractString.php
975 /modules/seigicookie/classes/configuration.php
976 /modules/seigicookie/util/configurator/configurator.php
977 /modules/seigicookie/util/configurator/translator.php
978 /modules/seigicookie/util/translator/TranslatorTrait.php
979 /modules/seigicookie/util/store/pstbconf.php
980 /modules/seigicookie/util/store/store.php
981 /modules/seigicookie/util/configurator/field.php
982 /modules/seigicookie/util/form/Field.php
983 /modules/mycustomscripts/mycustomscripts.php
984 /modules/mycustomscripts/translations/es.php
985 /modules/sendinblue/sendinblue.php
986 /modules/sendinblue/translations/es.php
987 /modules/sendinblue/services/ConfigService.php
988 /var/cache/prod/smarty/compile/warehouse/44/cb/f0/44cbf006b59b1307970aa823e3e0d5d2c5a217e9_2.file.tracking_script.tpl.php
989 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
990 /modules/iqitcountdown/iqitcountdown.php
991 /modules/iqitcountdown/translations/es.php
992 /modules/iqitsociallogin/iqitsociallogin.php
993 /modules/iqitsociallogin/translations/es.php
994 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
995 /modules/iqitfreedeliverycount/translations/es.php
996 /modules/ps_googleanalytics/ps_googleanalytics.php
997 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
998 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
999 /var/cache/prod/smarty/compile/warehouse/bf/8a/25/bf8a25cc3942b0af573eecccbd854a1180c567e3_2.file.ps_googleanalytics.tpl.php
1000 /modules/iqitcontactpage/iqitcontactpage.php
1001 /modules/iqitcontactpage/translations/es.php
1002 /classes/assets/PrestashopAssetsLibraries.php
1003 /modules/iqitwishlist/iqitwishlist.php
1004 /modules/iqitwishlist/src/IqitWishlistProduct.php
1005 /modules/iqitwishlist/translations/es.php
1006 /src/Core/Product/Search/ProductSearchContext.php
1007 /src/Core/Product/Search/ProductSearchQuery.php
1008 /src/Core/Product/Search/SortOrder.php
1009 /modules/ps_facetedsearch/ps_facetedsearch.php
1010 /modules/ps_facetedsearch/src/HookDispatcher.php
1011 /modules/ps_facetedsearch/src/Hook/Attribute.php
1012 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1013 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1014 /modules/ps_facetedsearch/src/Hook/Category.php
1015 /modules/ps_facetedsearch/src/Hook/Configuration.php
1016 /modules/ps_facetedsearch/src/Hook/Design.php
1017 /modules/ps_facetedsearch/src/Hook/Feature.php
1018 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1019 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1020 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1021 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1022 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1023 /modules/ps_facetedsearch/src/Hook/Product.php
1024 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1025 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1026 /modules/ps_facetedsearch/src/Filters/Provider.php
1027 /modules/ps_facetedsearch/src/URLSerializer.php
1028 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1029 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1030 /src/Core/Product/Search/FacetsRendererInterface.php
1031 /src/Core/Product/Search/ProductSearchProviderInterface.php
1032 /modules/ps_facetedsearch/src/Filters/Converter.php
1033 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1034 /src/Core/Product/Search/ProductSearchResult.php
1035 /classes/Manufacturer.php
1036 /modules/ps_facetedsearch/src/Product/Search.php
1037 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1038 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1039 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1040 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1041 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1042 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1043 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1044 /modules/ps_facetedsearch/src/Filters/Products.php
1045 /classes/stock/StockAvailable.php
1046 /modules/ps_facetedsearch/src/Filters/Block.php
1047 /src/Core/Product/Search/Facet.php
1048 /src/Core/Product/Search/Filter.php
1049 /vendor/prestashop/decimal/src/DecimalNumber.php
1050 /vendor/prestashop/decimal/src/Builder.php
1051 /src/Core/Product/Search/FacetCollection.php
1052 /classes/ProductAssembler.php
1053 /classes/Combination.php
1054 /classes/SpecificPrice.php
1055 /classes/tax/TaxManagerFactory.php
1056 /classes/tax/TaxRulesTaxManager.php
1057 /classes/tax/TaxManagerInterface.php
1058 /classes/tax/TaxCalculator.php
1059 /classes/GroupReduction.php
1060 /classes/Pack.php
1061 /classes/Feature.php
1062 /src/Core/Domain/Combination/CombinationSettings.php
1063 /classes/ProductPresenterFactory.php
1064 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1065 /src/Adapter/Presenter/Product/ProductPresenter.php
1066 /src/Adapter/Product/ProductColorsRetriever.php
1067 /src/Adapter/HookManager.php
1068 /src/Core/Product/ProductPresentationSettings.php
1069 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1070 /src/Adapter/Presenter/Product/ProductLazyArray.php
1071 /classes/Image.php
1072 /src/Core/Image/ImageFormatConfiguration.php
1073 /src/Core/Image/ImageFormatConfigurationInterface.php
1074 /classes/FeatureFlag.php
1075 /src/Core/FeatureFlag/FeatureFlagSettings.php
1076 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1077 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1078 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1079 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1080 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1081 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1082 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1083 /src/Core/Product/Search/Pagination.php
1084 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d8/7b/1b/d87b1b215153cffb9ab61a57e1e42c728c73eb1a_2.file.category.tpl.php
1085 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1086 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/3f/ec/833fec1ae94faa127c013cf9fc49e04731e06b9a_2.file.product-list.tpl.php
1087 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/44/73/b3/4473b302d943d0f730150c748357055d94f63d5d_2.file.layout-left-column.tpl.php
1088 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2d/bd/91/2dbd916925264a066c9f4eef5971720e442878c1_2.file.layout-both-columns.tpl.php
1089 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/db/35/28/db35288bc2b7165721176c33f0c5442e04a99d4d_2.file.helpers.tpl.php
1090 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1091 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1a/73/6a/1a736a2494ae480a692431543f3ab1c6d1360013_2.file.head.tpl.php
1092 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/71/1d/be711da6e5fea768b23d6bb249a00633b551853a_2.file.head-jsonld.tpl.php
1093 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/a0/4b/4b/a04b4b855d8063f426a23d57eee03371b900d7e1_2.file.product-list-jsonld.tpl.php
1094 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/fe/d1/28/fed128fb8259fa6bbff38cdfa1c69a81235d0f20_2.file.pagination-seo.tpl.php
1095 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1096 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1097 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7e/db/30/7edb3033f4b3450f48c34fc06e6b9048ed40d9b8_2.file.stylesheets.tpl.php
1098 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/40/1c/53/401c5351bc5c88b8f9551f22046c71b73714e611_2.file.javascript.tpl.php
1099 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1100 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f4/ba/41/f4ba41753745fa0d9caa8fb13c0e40a04056d996_2.file.product-activation.tpl.php
1101 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/76/fe/5f/76fe5f2fafd395d8ffd1d039d9122021f78ac225_2.file.header.tpl.php
1102 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ae/49/46/ae4946180263e69c18fd9e8d8727c59823b2d109_2.file.social-links.tpl.php
1103 /modules/iqitlinksmanager/iqitlinksmanager.php
1104 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1105 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1106 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1107 /modules/iqitlinksmanager/translations/es.php
1108 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1109 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1110 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1111 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/52/e3/5b/52e35b71c6bfa737e101a1641a85163fac7db9cd.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1112 /modules/ps_languageselector/ps_languageselector.php
1113 /modules/ps_currencyselector/ps_currencyselector.php
1114 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1115 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/77/50/f9/7750f90eeb007e5ded09a739b3557610b947e3d3_2.file.header-4.tpl.php
1116 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/71/54/c6/7154c63963691cd3307f43a42b82347a18839712.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1117 /modules/iqitsearch/iqitsearch.php
1118 /modules/iqitsearch/translations/es.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1120 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1122 /modules/ps_customersignin/ps_customersignin.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1124 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1125 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1126 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1127 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1128 /modules/paypal/classes/InstallmentBanner/Banner.php
1129 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/29/59/0d295994fd4907568bf553cb5430686a48ff9095_2.file.mobile-header-1.tpl.php
1130 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1131 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1132 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1133 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/20/05/35/20053516f7fc3524b22762ff9889ac19962ece1b_2.file.breadcrumb.tpl.php
1134 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/21/51/7c/21517cb6acee435d4f68b19ecedba41d3cbe3ad6_2.file.notifications.tpl.php
1135 /modules/pscartbanner/pscartbanner.php
1136 /modules/pscartbanner/translations/es.php
1137 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bc/2d/c5/bc2dc521e470f6a28c509f7dff77818700ee70f6_2.file.category-header.tpl.php
1138 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c0/ce/94/c0ce943443f981438fbe772f521b4685e4adba6c_2.file.products-top.tpl.php
1139 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2f/4c/a6/2f4ca6a26ef0e8aecf042c91d784b06bc5d4c69d_2.file.sort-orders.tpl.php
1141 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/dc/a8/08dca8bca8d498b744399bba3a0a0197cbc8b6a7_2.file.products.tpl.php
1142 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/eb/0f/b4eb0f43031084f59caf724b1434e2159199dfe7_2.file.product.tpl.php
1143 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/27/6a/31/276a3114e5aba18fede6914079f71ea9a664c6a0_2.file.product-miniature-1.tpl.php
1144 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e0/2c/7f/e02c7f04f61954c6b05d5c96d2a1715223d47afa_2.file.product-miniature-thumb.tpl.php
1145 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1146 /modules/iqitproductflags/iqitproductflags.php
1147 /modules/iqitproductflags/translations/es.php
1148 /src/Adapter/ContainerFinder.php
1149 /src/PrestaShopBundle/DependencyInjection/CacheAdapterFactory.php
1150 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriverChain.php
1151 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/ImplicitlyIgnoredAnnotationNames.php
1152 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/IgnoreAnnotation.php
1153 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/PhpParser.php
1154 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityRepository.php
1155 /vendor/doctrine/persistence/src/Persistence/ObjectRepository.php
1156 /src/PrestaShopBundle/Service/Database/DoctrineNamingStrategy.php
1157 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UnderscoreNamingStrategy.php
1158 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamingStrategy.php
1159 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DefaultQuoteStrategy.php
1160 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/SQLResultCasing.php
1161 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/QuoteStrategy.php
1162 /vendor/doctrine/doctrine-bundle/Mapping/ContainerEntityListenerResolver.php
1163 /vendor/doctrine/doctrine-bundle/Mapping/EntityListenerServiceResolver.php
1164 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListenerResolver.php
1165 /vendor/doctrine/doctrine-bundle/Repository/ContainerRepositoryFactory.php
1166 /vendor/doctrine/orm/lib/Doctrine/ORM/Repository/RepositoryFactory.php
1167 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/NotSupported.php
1168 /vendor/doctrine/orm/lib/Doctrine/ORM/Exception/ORMException.php
1169 /vendor/doctrine/orm/lib/Doctrine/ORM/ORMException.php
1170 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManager.php
1171 /vendor/doctrine/orm/lib/Doctrine/ORM/EntityManagerInterface.php
1172 /vendor/doctrine/persistence/src/Persistence/ObjectManager.php
1173 /vendor/doctrine/doctrine-bundle/ConnectionFactory.php
1174 /src/PrestaShopBundle/DependencyInjection/RuntimeConstEnvVarProcessor.php
1175 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/EnvVarProcessorInterface.php
1176 /vendor/symfony/symfony/src/Symfony/Bridge/Doctrine/ContainerAwareEventManager.php
1177 /vendor/doctrine/event-manager/src/EventManager.php
1178 /vendor/doctrine/dbal/lib/Doctrine/DBAL/DriverManager.php
1179 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/MySQL/Driver.php
1180 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOMySql/Driver.php
1181 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/AbstractMySQLDriver.php
1182 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver.php
1183 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ExceptionConverterDriver.php
1184 /vendor/doctrine/dbal/lib/Doctrine/DBAL/VersionAwarePlatformDriver.php
1185 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Connection.php
1186 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Connection.php
1187 /vendor/doctrine/dbal/lib/Doctrine/DBAL/TransactionIsolationLevel.php
1188 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ParameterType.php
1189 /vendor/doctrine/dbal/lib/Doctrine/DBAL/FetchMode.php
1190 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Query/Expression/ExpressionBuilder.php
1191 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Connection.php
1192 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOConnection.php
1193 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOQueryImplementation.php
1194 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ServerInfoAwareConnection.php
1195 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDO/Statement.php
1196 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatement.php
1197 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/PDOStatementImplementations.php
1198 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Statement.php
1199 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/ResultStatement.php
1200 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Driver/Result.php
1201 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Events.php
1202 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MariaDb1027Platform.php
1203 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/MySqlPlatform.php
1204 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/AbstractPlatform.php
1205 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/DateIntervalUnit.php
1206 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Platforms/TrimMode.php
1207 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Types.php
1208 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/Type.php
1209 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ArrayType.php
1210 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/AsciiStringType.php
1211 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/StringType.php
1212 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BigIntType.php
1213 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpIntegerMappingType.php
1214 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BinaryType.php
1215 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BlobType.php
1216 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/BooleanType.php
1217 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateType.php
1218 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateImmutableType.php
1219 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateIntervalType.php
1220 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeType.php
1221 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/PhpDateTimeMappingType.php
1222 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeImmutableType.php
1223 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzType.php
1224 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DateTimeTzImmutableType.php
1225 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/DecimalType.php
1226 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/FloatType.php
1227 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/GuidType.php
1228 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/IntegerType.php
1229 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonType.php
1230 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/JsonArrayType.php
1231 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/ObjectType.php
1232 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SimpleArrayType.php
1233 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/SmallIntType.php
1234 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TextType.php
1235 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeType.php
1236 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TimeImmutableType.php
1237 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Types/TypeRegistry.php
1238 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataFactory.php
1239 /vendor/doctrine/persistence/src/Persistence/Mapping/AbstractClassMetadataFactory.php
1240 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadataFactory.php
1241 /vendor/doctrine/orm/lib/Doctrine/ORM/UnitOfWork.php
1242 /vendor/doctrine/persistence/src/Persistence/PropertyChangedListener.php
1243 /vendor/doctrine/orm/lib/Doctrine/ORM/Event/ListenersInvoker.php
1244 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/IdentifierFlattener.php
1245 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/HydrationCompleteHandler.php
1246 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Reflection/ReflectionPropertiesGetter.php
1247 /vendor/doctrine/persistence/src/Persistence/Mapping/RuntimeReflectionService.php
1248 /vendor/doctrine/persistence/src/Persistence/Mapping/ReflectionService.php
1249 /vendor/doctrine/orm/lib/Doctrine/ORM/Proxy/ProxyFactory.php
1250 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/AbstractProxyFactory.php
1251 /vendor/doctrine/common/lib/Doctrine/Common/Proxy/ProxyGenerator.php
1252 /vendor/doctrine/doctrine-bundle/ManagerConfigurator.php
1253 /vendor/doctrine/persistence/src/Persistence/Mapping/ProxyClassNameResolver.php
1254 /vendor/doctrine/persistence/src/Persistence/Proxy.php
1255 /modules/iqitproductflags/src/Entity/IqitProductFlag.php
1256 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadata.php
1257 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ClassMetadataInfo.php
1258 /vendor/doctrine/persistence/src/Persistence/Mapping/ClassMetadata.php
1259 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/Instantiator.php
1260 /vendor/doctrine/instantiator/src/Doctrine/Instantiator/InstantiatorInterface.php
1261 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/TokenParser.php
1262 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Enum.php
1263 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attribute.php
1264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Attributes.php
1265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/NamedArgumentConstructor.php
1266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/NamedArgumentConstructorAnnotation.php
1267 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/IdentityGenerator.php
1268 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AbstractIdGenerator.php
1269 /vendor/doctrine/orm/lib/Doctrine/ORM/Events.php
1270 /modules/iqitproductflags/src/Entity/IqitProductFlagLang.php
1271 /src/PrestaShopBundle/Entity/Shop.php
1272 /modules/iqitproductflags/src/Entity/IqitProductFlagCategory.php
1273 /vendor/doctrine/persistence/src/Persistence/Reflection/RuntimeReflectionProperty.php
1274 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionProperty.php
1275 /vendor/doctrine/persistence/src/Persistence/Reflection/TypedNoDefaultReflectionPropertyBase.php
1276 /modules/iqitproductflags/src/Repository/FlagRepository.php
1277 /vendor/doctrine/orm/lib/Doctrine/ORM/QueryBuilder.php
1278 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Select.php
1279 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Base.php
1280 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/From.php
1281 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Join.php
1282 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Andx.php
1283 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/Composite.php
1284 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parameter.php
1285 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParameterTypeInferer.php
1286 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Expr/OrderBy.php
1287 /vendor/doctrine/orm/lib/Doctrine/ORM/Query.php
1288 /vendor/doctrine/orm/lib/Doctrine/ORM/AbstractQuery.php
1289 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Parser.php
1290 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Lexer.php
1291 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ParserResult.php
1292 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/ResultSetMapping.php
1293 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectStatement.php
1294 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Node.php
1295 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectExpression.php
1296 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/SelectClause.php
1297 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/RangeVariableDeclaration.php
1298 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Join.php
1299 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationPathExpression.php
1300 /vendor/doctrine/orm/lib/Doctrine/ORM/Id/AssignedGenerator.php
1301 /src/PrestaShopBundle/Entity/Lang.php
1302 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/JoinAssociationDeclaration.php
1303 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalPrimary.php
1304 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ArithmeticExpression.php
1305 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/PathExpression.php
1306 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InputParameter.php
1307 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ComparisonExpression.php
1308 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/InExpression.php
1309 /src/PrestaShopBundle/Entity/ShopGroup.php
1310 /src/PrestaShopBundle/Entity/ShopUrl.php
1311 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/IdentificationVariableDeclaration.php
1312 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/FromClause.php
1313 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/WhereClause.php
1314 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/NullComparisonExpression.php
1315 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/EmptyCollectionComparisonExpression.php
1316 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalExpression.php
1317 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Literal.php
1318 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/ConditionalTerm.php
1319 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByItem.php
1320 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/OrderByClause.php
1321 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/SqlWalker.php
1322 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/TreeWalker.php
1323 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/SingleSelectExecutor.php
1324 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/Exec/AbstractSqlExecutor.php
1325 /vendor/doctrine/dbal/lib/Doctrine/DBAL/LockMode.php
1326 /vendor/doctrine/orm/lib/Doctrine/ORM/Utility/PersisterHelper.php
1327 /src/PrestaShopBundle/Entity/Translation.php
1328 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/SizeFunction.php
1329 /vendor/doctrine/orm/lib/Doctrine/ORM/Query/AST/Functions/FunctionNode.php
1330 /vendor/doctrine/common/lib/Doctrine/Common/Util/ClassUtils.php
1331 /vendor/doctrine/persistence/src/Persistence/Mapping/MappingException.php
1332 /vendor/doctrine/dbal/lib/Doctrine/DBAL/SQLParserUtils.php
1333 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/Result.php
1334 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverStatement.php
1335 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Result.php
1336 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Abstraction/Result.php
1337 /vendor/doctrine/dbal/lib/Doctrine/DBAL/ForwardCompatibility/DriverResultStatement.php
1338 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/ObjectHydrator.php
1339 /vendor/doctrine/orm/lib/Doctrine/ORM/Internal/Hydration/AbstractHydrator.php
1340 /modules/iqitproductflags/src/Presenter/FlagPresenter.php
1341 /var/cache/prod/smarty/compile/warehouse/dd/60/fb/dd60fb786b3e364dde5c66bdff67eb51b63dea01_2.module.iqitproductflagsviewstemplateshookminiature.tpl.php
1342 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ee/0b/7c/ee0b7c45c528294259a7a05da58b96eb0eff1ec9_2.file.product-miniature-btn.tpl.php
1343 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/bc/03/b2/bc03b2ff1023dd829c6b54a8344ef15e6d870394_2.file.variant-links.tpl.php
1344 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
1345 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/07/85/ce/0785ce1e9be28d968c944117431b4c94a64550a1_2.file.pagination.tpl.php
1346 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/23/29/2a/23292a086acf77d29ce5730ff2b500649d598776_2.file.products-bottom.tpl.php
1347 /modules/ps_categorytree/ps_categorytree.php
1348 /var/cache/prod/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1349 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1350 /var/cache/prod/smarty/compile/warehouse/65/81/c3/6581c367e3a3eca764f7413568539628f75a7d3d_2.module.ph_simpleblogviewstemplateshook1.7leftcolumn.tpl.php
1351 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0b/51/21/0b5121813696ad49b6f25f66cc7cb7d7f2528704_2.file.footer.tpl.php
1352 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/92/f5/82/92f58245346958e3843f08661d992ade3e898191_2.file.footer-1.tpl.php
1353 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/52/e3/5b/52e35b71c6bfa737e101a1641a85163fac7db9cd.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1354 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/21/warehouse/b6/5f/4a/b65f4ad0564dc3c351fcaa2a8666296c41ff35c0.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1355 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1356 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/11/12/b41112fc16e017d8695d5d00705a108fb7479c5b_2.file.footer-copyrights-1.tpl.php
1357 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/4a/8d/17/4a8d172156fd733edfbd41db5bc2f7d544b8a8bf_2.file.password-policy-template.tpl.php
1358 /var/cache/prod/smarty/cache/iqitpopup/1/1/1/21/warehouse/ac/8f/5f/ac8f5f393189aa7049d746f8b132925c52585a71.iqitpopupviewstemplateshookiqitpopup.tpl.php
1359 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1360 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1361 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1362 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1363 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1364 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1365 /var/cache/prod/smarty/compile/warehouse/7f/41/b8/7f41b812e59b1b33d0f9e242a79da71da2661853_2.file.ga_tag.tpl.php
1366 /override/classes/form/CustomerLoginForm.php
1367 /classes/form/CustomerLoginForm.php
1368 /classes/form/AbstractForm.php
1369 /classes/form/FormInterface.php
1370 /src/Core/Foundation/Templating/RenderableInterface.php
1371 /classes/form/CustomerLoginFormatter.php
1372 /classes/form/FormFormatterInterface.php
1373 /classes/ValidateConstraintTranslator.php
1374 /src/Core/Util/InternationalizedDomainNameConverter.php
1375 /src/Core/Foundation/Templating/RenderableProxy.php
1376 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1377 /classes/form/FormField.php
1378 /var/cache/prod/smarty/compile/warehouse/80/2a/3d/802a3d846544be4b41c217585ac7b64368bd73b5_2.file.login-form.tpl.php
1379 /var/cache/prod/smarty/compile/warehouse/f0/0d/6c/f00d6c86435903906ffadfe550a63b26e96764af_2.file.form-errors.tpl.php
1380 /var/cache/prod/smarty/compile/b7/28/36/b728364b8d7c3c9fd6cd64f86146e3893b23f466_2.file.form-fields.tpl.php
1381 /var/cache/prod/smarty/compile/f0/0d/6c/f00d6c86435903906ffadfe550a63b26e96764af_2.file.form-errors.tpl.php
1382 /var/cache/prod/smarty/compile/warehouse/9e/ae/75/9eae75eec850560c02af841e8e8db5df1d4187bb_2.file.captcha.tpl.php
1383 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/fd/8f/f2/fd8ff2bfb64afd38bee75ef4c6b3e6568c6bbe52.iqitsocialloginviewstemplateshookauthentication.tpl.php